KEGG   Bacillus anthracis Vollum: DJ46_4254Help
Entry
DJ46_4254         CDS       T03475                                 

Definition
(GenBank) peptidase M20/M25/M40 family protein
  KO
K19701  aminopeptidase YwaD [EC:3.4.11.6 3.4.11.10]
Organism
banv  Bacillus anthracis Vollum
Brite
KEGG Orthology (KO) [BR:banv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:banv01002]
    DJ46_4254
Enzymes [BR:banv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     DJ46_4254
    3.4.11.10  bacterial leucyl aminopeptidase
     DJ46_4254
Peptidases and inhibitors [BR:banv01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   DJ46_4254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 PA Peptidase_M20 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AIK62842
Position
3970192..3971592
Genome map
AA seq 466 aa AA seqDB search
MKKSLKQKIVSSLLAVSLAVSLAPIGQANADSTSEIKQTSSITKQVDASRAIEHIRFLSE
TIGPRPGGTKSEEWASRYVGMQLKSMGYEVEYQPFQVPDQYVGFIESPLSTKRNWQTGAA
PNALISTESVTAPLIFVQGGTKLEDIPNEVNGKIVLFERGTTVADYNKQVENAVSKGAKG
VLLYSLIGGRGNYGQTFNPRLTKKQSIPVFGLAYAQGNAFKEEIAKKGTTILSLKARHES
NLTSLNVIAKKKPKNSTGNEKAVVVSSHYDSVVGAPGANDNASGTGLVLELARAFQNVET
DKEIRFIAFGSEETGLLGSDYYVNSLSPKERDRILGVFNADMVATNYDKAKNLYAMMPNG
SPNLVTDAALQAGKQLNNDLVLQGKFGSSDHVPFAEVGIPAALFIWMGVDSWNPLIYHIE
KVYHTPQDNVFENISPERMKMALEVIGTGVYNTLQQSVTQTEQKAA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatctttgaaacaaaaaatagtaagctccttgcttgctgtatcactcgctgtt
agcttagctccgattggacaagctaacgctgattccacgtcagaaatcaagcagacttca
tctatcacaaaacaagttgatgcaagccgcgctatcgaacacatccgtttcttatccgaa
acaattggtcctcgacctggtgggacaaaatcagaagaatgggcttctcgctacgttggt
atgcagcttaaatcaatgggctacgaagtagaatatcaaccatttcaagtgccggatcaa
tacgttggatttattgaatcaccattatccacaaagcgtaattggcaaactggtgctgcc
cctaatgcactaatttctacagaatctgttacagctcctcttatctttgttcaaggtggg
acaaaattagaggatatcccaaatgaagtaaatggaaaaattgttctattcgaaagagga
acaacagtagctgactataataaacaagttgaaaatgctgttagcaaaggagcaaaaggt
gttcttttatacagtttaattggtggacgtggaaactacggacaaactttcaatccccgc
ctaacgaaaaagcaatctatccctgtctttggtcttgcttatgcgcaaggaaatgcattt
aaagaagaaatcgctaaaaaaggaacaacaattctttccctaaaagcgagacatgaatct
aatttaacatcattaaacgtcatcgctaaaaagaaaccaaaaaacagtacaggtaatgaa
aaagctgtcgttgtaagctcacactacgatagtgtcgttggagcacctggagcaaatgat
aatgcttctggtacaggattagtattagaattagctcgtgcttttcaaaatgtagaaact
gataaagaaattcgttttattgcttttggttctgaagagactggcttacttggctccgat
tattacgttaatagcttatccccaaaagaacgcgatcgaattttaggtgtctttaacgca
gacatggtcgcaacaaattacgataaagcaaagaatttatatgctatgatgcctaacggt
tctccaaaccttgtaacagacgcagccttacaagcaggtaaacaattaaataatgacctc
gttctgcaagggaaatttggctctagtgatcacgtaccgtttgctgaagttggtattcct
gcggctctatttatttggatgggtgtcgatagttggaatccattaatctaccatatcgaa
aaggtatatcacacacctcaagataacgtatttgagaatatttcacctgaacgtatgaaa
atggcactagaagtaatcggaactggtgtttataacactcttcaacaatctgttacgcaa
acagaacagaaagctgcttaa

DBGET integrated database retrieval system