KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_0783Help
Entry
BAMF_0783         CDS       T01321                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00010  Glycolysis / Gluconeogenesis
bao00020  Citrate cycle (TCA cycle)
bao00620  Pyruvate metabolism
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01120  Microbial metabolism in diverse environments
bao01130  Biosynthesis of antibiotics
bao01200  Carbon metabolism
Module
bao_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMF_0783 (acoC)
   00020 Citrate cycle (TCA cycle)
    BAMF_0783 (acoC)
   00620 Pyruvate metabolism
    BAMF_0783 (acoC)
Enzymes [BR:bao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAMF_0783 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 HlyD_D23 PYNP_C GCV_H EF_TS
Motif
Other DBs
NCBI-ProteinID: CBI41909
Position
829574..830767
Genome map
AA seq 397 aa AA seqDB search
MAVKVVMPKLGMAMKQGEVSVWNKKVGDPVEKGESIASINSEKIEMEVEAPESGTLLHIK
VKEGEGVPPGTAICYIGENGEKVQEKEAPAPENAGEPQAEPETIPAPKAGKERKHRVKIS
PVARKMAEKAGLKVDTLNGTGPGGRIVKADVIKAMKTEAEPRSSVQTAQPEGKPASAMRK
VIADRMHKSLQNSAQLTLTMKADITELVKWQKQLADSAKKRSGVKLTVTHFVSRAAVLAL
KQHPELNSSYQEERIITYPHVHLGMAVSLENGLVVPVIRDAEKLSFLELADQISTSARRA
REGNASGDDLHGSTFSITNLGGYGIEHFTPILNPPEAGILGVGASYETPAFKGDELVKST
VLPLSLTFDHRVCDGAPAADFLKTVKALLEEPAGLIL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaagtagtaatgccgaaattgggaatggcgatgaagcaaggtgaagtatca
gtctggaataagaaagtcggcgatccggttgaaaagggagaaagcatcgccagcatcaac
tctgaaaaaatagaaatggaagtagaagcgcccgaaagcggcacgctccttcacattaaa
gtcaaagagggagaaggagttccgccgggaacggccatctgttatatcggggaaaacggt
gaaaaggtgcaggagaaggaggcaccggcccctgaaaatgccggggaaccacaagcagaa
cctgaaactattcccgctcccaaagccgggaaagagcgtaaacaccgcgtgaaaatatcc
cctgtggcccgaaaaatggcggagaaggcaggattgaaagttgatacgctgaacgggacg
gggcccgggggcagaatcgtaaaagccgacgtcataaaggcgatgaagacggaagctgaa
ccgcggtcttcggttcagacggcacagccggagggaaaaccggcctcagcaatgagaaaa
gtgattgcagaccgaatgcacaaaagcctgcaaaacagcgcccagctgacactgaccatg
aaagcggacattacggagcttgtgaaatggcagaaacagctggccgacagtgcgaaaaag
cggagcggtgttaaactgacggtcacgcattttgtatcccgggccgcggtgcttgcgctg
aaacagcatcctgagctgaacagctcttatcaagaggagcggatcattacctatccgcat
gtccatctcgggatggcagtttctcttgaaaacggccttgtcgtgccggtgatccgtgat
gcggaaaagctttcattccttgagcttgcggatcaaatcagcacatctgcacgccgggcg
cgggaaggaaatgcttccggagatgatcttcacgggtcgactttttctattacaaatctc
gggggatatggaattgaacatttcaccccgatccttaatccgcctgaagccggtattctc
ggagtgggcgcaagctatgaaacgccggcgttcaaaggagatgagcttgtcaaaagcacc
gtgctgccgctgagcctcacctttgatcacagagtatgtgacggtgctccggctgcggac
ttcctgaaaacggttaaagcgctgcttgaagagccggccggattgattttatag

DBGET integrated database retrieval system