KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1037Help
Entry
BAMF_1037         CDS       T01321                                 

Gene name
phoA
Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00730  Thiamine metabolism
bao00790  Folate biosynthesis
bao01100  Metabolic pathways
bao02020  Two-component system
Module
bao_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BAMF_1037 (phoA)
   00790 Folate biosynthesis
    BAMF_1037 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAMF_1037 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bao04147]
    BAMF_1037 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bao00537]
    BAMF_1037 (phoA)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BAMF_1037 (phoA)
Exosome [BR:bao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAMF_1037 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bao00537]
 Enzymes
  BAMF_1037 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: CBI42163
Position
complement(1061372..1062751)
Genome map
AA seq 459 aa AA seqDB search
MSLFKQVRSKLLPAAAVSVLTAGLIAGAGLQHSDQAAAKKQPEKNEIRNVIFMIGDGMGA
PYMNAYRSVINKGKPSDGMKLTAFDPNLTGMMMTYPDDPDSNITDSAAAGTAMATGVKTY
NAAIGVDKKGKRVKSVLEEAKQRGKSTGLVATSEIAHATPAAFGAHNKSRKNMDEIASSY
FDDRINGQQKVDVLLGGGKSNFIRKDRNITKDFKKAGYSYVTSKQELKKDRNKKVLGLFA
DGGLDKAIDRSNAVPSLEDMTTAAIDRLNSNKKGFFLMVEGSQIDWAGHDNDIVGAMSEM
KDFEKAYKAAIAFAKKDKHTLVIATADHTTGGLTIGANNDKNWHVEPVLAAKKTPAFMAD
QIKAGKSVSSVLARYTDLKWSKDEIKQIETAAKQDADKGAYKAIIKLFNAKTNSGWTTGD
HTGEEVPVYAYGPGKESFAGLLNNTDQAKKIFHILKSGK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatttaaacaggttcgatcaaaacttctgccggcggcagccgtatccgtgctg
acagccggtctgattgcgggtgcggggcttcagcactctgatcaggctgcggcaaaaaaa
cagcctgagaaaaacgagatcagaaacgtcatcttcatgatcggagacggaatgggcgcg
ccatacatgaacgcctaccgttcggtcattaacaaaggaaagccttctgacggcatgaaa
ctgacggcatttgaccccaatcttaccggcatgatgatgacttatcctgacgatcctgat
tccaatatcaccgattccgcggcggccggcacggcaatggccaccggcgtgaaaacgtat
aacgcggcgatcggggtcgataaaaaaggaaagcgggtaaaatccgtccttgaagaagcg
aaacaaagaggcaaatcaactggacttgtcgcgacttcagagattgcccacgcaacccct
gcggcattcggagcccataacaaatccagaaaaaatatggatgaaatcgcgagcagctac
tttgatgaccgcatcaacggacaacagaaagtggatgtgctcctcggaggcggcaaatca
aactttatccgtaaagaccggaatataacgaaggatttcaaaaaagcgggatacagctat
gttacatcaaaacaggagcttaaaaaggaccgcaataaaaaggttctcggcctgtttgcc
gatggcggactcgacaaagcgatcgaccgttcaaacgccgtcccttcattagaagacatg
acaacggcagcaatcgacagactgaactcgaataaaaaagggtttttcttaatggtcgaa
ggcagccaaattgactgggccggacatgacaacgatatagtcggcgcaatgagcgaaatg
aaggattttgaaaaagcgtataaagcagcgatcgcatttgccaaaaaggacaaacatacg
cttgtcatcgctacggctgatcacacgaccggcggattgacaatcggagcgaacaacgat
aaaaactggcatgttgaaccggttcttgcagcgaaaaaaacgccggcatttatggctgac
caaatcaaagctggcaaatccgtatcttccgtgcttgcgcgttataccgacctgaaatgg
tcaaaagatgaaatcaaacagatcgaaacggctgcaaagcaggatgctgacaagggcgcc
tacaaagcgatcattaagctctttaatgcaaaaaccaacagcggctggacaaccggcgat
catacgggcgaagaagttcccgtttacgcatacggtccaggaaaagaatcatttgcgggg
cttttaaacaacacggatcaggccaaaaagatctttcacatcttaaaaagcggcaaataa

DBGET integrated database retrieval system