KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_1848Help
Entry
BAMF_1848         CDS       T01321                                 

Gene name
RBAM017440
Definition
(GenBank) RBAM017440
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00010  Glycolysis / Gluconeogenesis
bao00071  Fatty acid degradation
bao00350  Tyrosine metabolism
bao00625  Chloroalkane and chloroalkene degradation
bao00626  Naphthalene degradation
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01120  Microbial metabolism in diverse environments
bao01130  Biosynthesis of antibiotics
bao01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMF_1848 (RBAM017440)
  Lipid metabolism
   00071 Fatty acid degradation
    BAMF_1848 (RBAM017440)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAMF_1848 (RBAM017440)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAMF_1848 (RBAM017440)
   00626 Naphthalene degradation
    BAMF_1848 (RBAM017440)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAMF_1848 (RBAM017440)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 CdhD 2-Hacid_dh_C Methyltransf_25 Methyltransf_31 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: CBI42974
Position
complement(1917508..1918524)
Genome map
AA seq 338 aa AA seqDB search
MKAVIATKDKNIAIVQKELRPLRHGEAKVKMEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGIVTEIGEGVSSLKKGDRVSIAWMFESCGRCEYCLTGRETLCRDVKNAGYTVDGAMAEE
AIVAVDYAVKVPEHLDPAAASSITCAGVTTYKAVKVSEIKPGQWIGVFGVGGLGNLAVQY
AKNVFNAKVIAFDISDEKLNFAKSLGADAVVNSLNEDPVEKAKEVTSDLGLDAAVITAVS
KTPFNQAIDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIQVVGSLVGTREDLKEAFRFAA
DGKVVPKVTKRPIEDVNDIFEEMEQGKVTGRMVIDFTC
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccgtaatagcgacgaaagacaaaaatatagcgatcgtacaaaaagaattacgt
cctttgcgacatggtgaagccaaagttaagatggaatactgcggtgtatgtcatactgac
ttgcatgttaaaaatgctgatttcggggatgtgacaggcgtcactttaggtcatgaagga
ataggcattgtaaccgagattggtgaaggcgtatcaagcctgaaaaaaggagaccgcgtc
tctattgcgtggatgtttgaaagctgcggccgctgtgaatattgcttaacaggccgtgaa
accctgtgccgtgatgtaaaaaatgccggctatacagttgatggcgcgatggctgaagaa
gcaatcgtagcggttgattatgcagtgaaagtgcctgaacatttagatccggcagcagca
agcagcattacttgtgcaggcgtaacaacttataaagcagtaaaagtcagtgaaattaag
cctggtcaatggatcggtgtatttggagtcggcggtttgggcaacttggctgttcaatat
gcaaagaatgtctttaacgctaaagtgattgctttcgacattagcgatgaaaagttgaat
tttgctaagagcttaggtgctgacgcggttgtaaacagtttaaacgaagaccctgtcgag
aaggctaaagaagtgaccagcgatttaggacttgatgctgcggtcattaccgctgtctct
aaaacccctttcaatcaagcgattgatgttgtaaaagcaggagcgcgagtagttgctgtc
ggtttaccggtagataagatggacttagatattccccgtcttgtgttagatggaattcag
gtagtaggttcattagtaggtaccagagaagacctgaaggaagctttccgattcgctgca
gacggtaaagttgtacctaaagtgacaaagcgcccgatcgaagacgtgaatgatatattt
gaagaaatggagcaaggtaaagtgaccggccgtatggttatagattttacttgttaa

DBGET integrated database retrieval system