KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2285Help
Entry
BAMF_2285         CDS       T01321                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00030  Pentose phosphate pathway
bao00480  Glutathione metabolism
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01120  Microbial metabolism in diverse environments
bao01130  Biosynthesis of antibiotics
bao01200  Carbon metabolism
Module
bao_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bao_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAMF_2285 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAMF_2285 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bao04147]
    BAMF_2285 (zwf)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BAMF_2285 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BAMF_2285 (zwf)
Exosome [BR:bao04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BAMF_2285 (zwf)
  Exosomal proteins of colorectal cancer cells
   BAMF_2285 (zwf)
  Exosomal proteins of bladder cancer cells
   BAMF_2285 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: CBI43411
Position
2347049..2348518
Genome map
AA seq 489 aa AA seqDB search
MKTNDKPKAVIVIFGATGDLAKRKLYPSIHRLYKNGQIGEEFAVVGVGRRPWSNEDLRET
VKTSVSSAGQKDTDDFTSHFYYHPFDVTNPGSYQELNVLLDRLEHTYEIPNNRMFYLAMA
PEFFGTIAKSLKNEGVTATKGWSRLVIEKPFGHDLPSAKELNKEIREAFTEDQIYRIDHY
LGKQMVQNIEVIRFANALFEPLWNNRYISNIQITSSEDLGVEDRARYYEKSGALRDMVQN
HILQMVALLAMEPPIKLNTEEIRSEKVKVLRALRPVAQNEVNDYFVRGQYQAGTIDGTPV
ASYTDEHNVAPDSNTETFVSGKLLIDNFRWAGVPFYIRTGKRMKEKSTKIVVQFKDIPMN
LYYGNETNVNPNLLVIHIQPDEGITLYLNAKKLGGAAHAQPIKLDYCSNCSDEMNTPEAY
EKLIHDCLLGDATNFAHWDEVALSWNFVDAISETWAADKTLSPNYEAGSMGPKASDDLLE
KDGLHWWNI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacaaacgacaaaccaaaagcagtaattgtaatatttggtgccacaggggatttg
gcaaaacgaaaactttacccatccattcatcgtttatataaaaatggtcaaattggtgaa
gagtttgcagttgtaggtgttggaagaagaccttggtcaaacgaggacctccgggaaacc
gttaaaacgtctgtttcttcggctgggcaaaaagacacagacgatttcacgtctcatttt
tattaccatccgtttgatgtaacgaatccgggttcctatcaggagctgaatgtcctgctt
gaccggcttgagcatacatatgaaatcccgaacaacagaatgttttacttggcgatggcc
cctgaatttttcggcactatcgcaaaatcgcttaaaaacgaaggtgtcacggcgacaaaa
ggctggtcccgtctcgtaattgaaaaaccgttcggccacgacctgccgagtgcgaaagag
cttaacaaagaaatacgcgaagcgttcacagaagatcaaatttatcggatcgaccattac
ttaggcaagcaaatggttcaaaacatcgaagtcatccggtttgcgaatgcactgtttgag
ccgctgtggaataaccgctacatctcaaacatccagattacgtcaagtgaagatctcggc
gttgaggaccgtgcgagatattatgagaaatcaggcgcactccgcgatatggttcagaat
catattttacaaatggtcgctcttttggcgatggaaccgccgattaaactgaacacggaa
gaaatccgcagcgaaaaagtgaaggtgctgagagcgctacgccctgtcgctcaaaacgaa
gtgaatgattacttcgtccgcggacaataccaagccggaacgatcgacggcacccctgta
gcgagttatacggatgagcataacgtagcgccggattccaatacggaaacattcgtgtcc
ggtaagctgttaatcgataacttccgctgggccggcgttccgttttatatccgcacagga
aaacggatgaaagaaaaatcaacgaaaattgtcgttcaatttaaagacattccgatgaac
ctttattacggcaatgaaacgaatgtaaatccgaacctgcttgtcatccacattcagccg
gatgaaggcatcactttatatctgaacgctaaaaaattaggcggagccgcacacgctcag
ccgattaagctggattactgcagcaactgcagtgatgaaatgaacacaccggaagcctat
gaaaaattaattcacgactgtctgctcggcgatgcgacgaacttcgcccattgggatgaa
gtagcgctttcctggaatttcgtcgatgcgatttccgaaacatgggctgccgacaaaacc
ctttctccgaattatgaagccggatcaatgggaccgaaggcttcggatgacctcttggaa
aaagacggccttcactggtggaatatataa

DBGET integrated database retrieval system