KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2306Help
Entry
BAMF_2306         CDS       T01321                                 

Gene name
ptb
Definition
(GenBank) phosphate butyryl coenzyme A transferase
  KO
K00634  phosphate butyryltransferase [EC:2.3.1.19]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00650  Butanoate metabolism
bao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAMF_2306 (ptb)
Enzymes [BR:bao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.19  phosphate butyryltransferase
     BAMF_2306 (ptb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB
Motif
Other DBs
NCBI-ProteinID: CBI43432
Position
complement(2368550..2369443)
Genome map
AA seq 297 aa AA seqDB search
MKLRDLVEKAAAKNAKTIAVAHAADKEVIQAVKMAAEHLSARFLLTGDSEKLKELLANEP
KFNADIIHADSPEESAAKAVRAVREQEADILMKGNLPSSTLLKSVLNRQEGLRSKSVLSH
VAVFEVPDYDRLMYVTDSALNIAPSLEELRHILQNAVHVAHSVGNPMPKAAVLAAIETVN
PKMEATLNAAAIVQMCNRGQITGCIADGPLALDNAVSQAAALQKGISGSVAGQADILLVP
SIEAGNMLYKSMIYFAKANVAAVIAGAKAPIALTSRADTAENKLYSIALAICASQEQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgagagacttagttgaaaaagccgcggcaaaaaacgcaaaaaccattgcagtg
gcccacgcagcagataaagaagtaatccaggctgtcaaaatggcggcagagcacttgtcg
gcacgatttttactgacgggtgacagcgaaaagctgaaagagcttctggcaaatgagccg
aagttcaatgctgacattatccacgccgattcacccgaagaatctgcggcaaaagcagtg
cgcgcagtacgcgaacaagaggcggatattttaatgaaagggaatctgccgagctcaact
cttctgaagtcggttttaaaccgccaggaagggctgcgttctaaaagtgtgttatcacat
gtagccgtttttgaggtgccggactatgaccggctgatgtatgtgactgattcagcgctg
aacatcgccccgtctcttgaagagctccggcatattctgcaaaatgcggttcatgtcgcg
cattcagtagggaaccctatgccgaaagccgcagtccttgcggctattgaaacggttaat
ccgaaaatggaggcgacgctgaacgcggctgcgatcgtccaaatgtgcaatagaggccag
attacaggctgtatcgcggacggaccgcttgctttggataatgccgtatctcaagctgca
gcactgcaaaaagggatttccggaagcgtagcgggccaggcggatattctcttggttcct
tcaatagaggctggaaatatgctttataagtcaatgatttattttgcgaaagcaaatgtt
gctgccgtcatcgcgggtgcgaaggcgccgattgcattaacgagcagagcggataccgca
gaaaataaactgtattcaattgcgcttgcgatttgcgcatcacaagaacagtag

DBGET integrated database retrieval system