KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2310Help
Entry
BAMF_2310         CDS       T01321                                 

Gene name
prpD
Definition
(GenBank) 2-methylcitrate dehydratase
  KO
K01720  2-methylcitrate dehydratase [EC:4.2.1.79]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BAMF_2310 (prpD)
Enzymes [BR:bao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.79  2-methylcitrate dehydratase
     BAMF_2310 (prpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: CBI43436
Position
complement(2372985..2374412)
Genome map
AA seq 475 aa AA seqDB search
MTETRRMDAVIEEISDYVLHQEIDSSEAFTTAGHVLLDTIGCGILALSYPECTKLLGPIV
PGTSVPNGSRVPGTPFVLDPVTAAFNIGCINRWLDYNDTWLAAEWGHPSDNLGGILACAD
YISRVRVSEGKEPFTVRDVLRAMIKAHEIQGILALENSLNRVGLDHVLFVKVATAAVCTQ
MLGGSKEEISNAVSHAWIDNSSLRTYRHAPNTGSRKSWAAGDATSRGVYLALMALKGEMG
YPTVLTAPGWGFQDVLFNQEEMKLARPLGSYVMENVLFKVSYPAEFHAQTAAECAVQLHP
EVKDRIGEIDRITILTHESAIRIIDKKGPLHNPADRDHCLQYITAIGLLFGDITADHYEE
ETASDPRIDTLRSKMEVTEHKAYSKDYLDPHKRSISNAVQVHFTDGTATERIECEYPLGH
RFRRKEAVPNILAKFSANVSTHFSLKQQHKIEEACKHSGRMQQLSVIEFMDLFLV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaacccgccgaatggacgccgtgatcgaagagatttctgattatgtgctccat
caagagattgacagttcagaagctttcactacggcaggacatgtgcttcttgatacgata
ggctgcggaattctggcgctcagctatcccgaatgtacaaagctgctcggcccgattgtt
ccgggaacctccgtgccgaacggaagcagagtccccggcacgccttttgttttagacccc
gtcacggccgcttttaatatcggatgtatcaacagatggctcgattataatgatacgtgg
cttgcggcggaatggggtcatccgtctgacaatctcggaggcattttggcctgtgcggac
tatatttccagagtaagggtgtctgaagggaaagaaccgtttaccgtgcgcgatgtgctt
cgcgcaatgatcaaagcgcacgaaatccaaggtattctcgctttggaaaacagtttaaac
agagtcggactggaccatgtgctgtttgtgaaagtggcgactgcggctgtttgcacgcaa
atgctgggcggttcaaaagaggaaatcagcaacgccgtatcacacgcctggattgacaat
tcaagcctcagaacgtaccggcatgcgccgaacaccggatcgcgcaaatcatgggcggcc
ggtgatgcgacgagcagaggcgtgtatttggccctcatggcgctgaaaggtgaaatggga
tacccgacggtgctgaccgcaccgggatggggatttcaagatgtattatttaatcaggag
gaaatgaagcttgcccgcccgcttggttcctatgttatggagaatgttttgtttaaagta
tcctatccggctgaattccacgcccaaacagctgcggaatgcgcggtccaactccatcct
gaggtgaaagaccgcatcggggaaatcgacagaatcacgattttgacgcatgagtcagcc
atccggattattgataaaaaaggcccgcttcacaatccggctgaccgggatcattgcctg
cagtacattacggcaatcgggctgcttttcggagatattacggcagaccattatgaagag
gaaacggcctctgacccgagaattgatacattgcggagcaaaatggaggtgacggaacat
aaagcgtactcaaaagattacttagacccgcataagcgatccatctcaaatgccgtgcag
gtgcattttacagacggcacagctacggaacggattgaatgtgaatacccgctcgggcac
cgattccgcagaaaagaagccgttccgaatattcttgccaagttttcagcaaacgtcagc
actcatttttcactgaagcagcagcataaaatagaagaagcctgcaaacatagcggacgg
atgcagcagctcagcgttattgaatttatggacttatttctcgtataa

DBGET integrated database retrieval system