KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2313Help
Entry
BAMF_2313         CDS       T01321                                 

Gene name
mmgB#
Definition
(GenBank) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00360  Phenylalanine metabolism
bao00362  Benzoate degradation
bao00650  Butanoate metabolism
bao01100  Metabolic pathways
bao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAMF_2313 (mmgB#)
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BAMF_2313 (mmgB#)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAMF_2313 (mmgB#)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     BAMF_2313 (mmgB#)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH
Motif
Other DBs
NCBI-ProteinID: CBI43439
Position
complement(2376723..2376998)
Genome map
AA seq 91 aa AA seqDB search
MPMINEAVYCLYEGAASKEAIDDVMKLGMRHPMGPLTLADFIGLDTCLSIMEVLYSGLGD
SKYRPCPLLRKYVSAGWLGKKSGRGFYEYNR
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgattaacgaggccgtttattgcctttacgaaggtgcggcctcaaaggaagcg
attgacgatgtgatgaagctcggcatgcgtcatccgatggggcctttaacattagccgat
ttcatcggattggatacgtgcctttccattatggaggttctctattcgggactcggagat
tcgaaatatcgtccatgccctctgctcagaaaatatgtcagcgccggctggctcggcaaa
aaaagcgggcgcggtttttatgagtacaacagatga

DBGET integrated database retrieval system