KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2315Help
Entry
BAMF_2315         CDS       T01321                                 

Gene name
mmgA
Definition
(GenBank) degradative acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00071  Fatty acid degradation
bao00072  Synthesis and degradation of ketone bodies
bao00280  Valine, leucine and isoleucine degradation
bao00310  Lysine degradation
bao00362  Benzoate degradation
bao00380  Tryptophan metabolism
bao00620  Pyruvate metabolism
bao00630  Glyoxylate and dicarboxylate metabolism
bao00640  Propanoate metabolism
bao00650  Butanoate metabolism
bao00900  Terpenoid backbone biosynthesis
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01120  Microbial metabolism in diverse environments
bao01130  Biosynthesis of antibiotics
bao01200  Carbon metabolism
bao01212  Fatty acid metabolism
bao02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAMF_2315 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BAMF_2315 (mmgA)
   00640 Propanoate metabolism
    BAMF_2315 (mmgA)
   00650 Butanoate metabolism
    BAMF_2315 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAMF_2315 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BAMF_2315 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAMF_2315 (mmgA)
   00310 Lysine degradation
    BAMF_2315 (mmgA)
   00380 Tryptophan metabolism
    BAMF_2315 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAMF_2315 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAMF_2315 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAMF_2315 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bao04147]
    BAMF_2315 (mmgA)
Enzymes [BR:bao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAMF_2315 (mmgA)
Exosome [BR:bao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAMF_2315 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: CBI43441
Position
complement(2377594..2378775)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAGISESEAEGAVMGMVVQAG
AGQIPARQAARHAGLPWSVPAETINKVCASGLRAVTICDQIIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSSAAKKYGISRDEQDHYAL
LSQKRAAEAAETGKLHEEIVPVTWTGKKGKQHTVAADEGLRPDTSLDQLAKLKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LKKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGIAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggctagaacgccgttcggaaaattcggcggggca
ttaaaagaggtaaaagcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccggcatcagtgaaagtgaagcagaaggtgcggtgatgggaatggtcgtccaggcgggc
gcggggcagattccggcgcggcaggctgcgaggcatgccgggcttccatggtccgttccg
gctgaaaccattaataaggtctgtgcatcggggctcagagccgttaccatctgtgatcaa
atcatccgggcgaaagatgcggacgtgctgattgcaggcggtatggaaagcatgagcaac
attccgtacgccattccggccggccgctggggtgtgaggatgggagacggggtttttcag
gatttaatggttcatgacgggctgacctgtgcgtttgatcaggtgcatatggctgtccac
ggaagctctgcggccaaaaagtacggcatttcccgagatgaacaggatcattacgctctt
ttaagccagaaacgcgcggctgaggcagctgagacgggtaaattgcatgaagaaatcgtc
cccgtcacctggaccggcaaaaagggcaaacagcatactgttgcagcagatgaggggctg
cgtccggatacaagccttgaccagctcgcaaagctcaaacctatttttacagccgacgga
acggtcaccgccggaaacgctcccggtgtaaatgacggcgccggagcatttgtgctgatg
tcggaggaaaaagccgcgaagcagcatgtcagaccgctcgctgcgatacttggttttgcg
tctgtcggactggaagcgtccgagcttgcaagcgcgccgggagaagccatcagccggctc
ttgaaaaaaaccggtttgtccgttgacgacatcgatttgtttgaagtgaatgaagcattt
gcgtccgtcgtcctcgtgagcgaaaaaatagccgggttcagccgggagaaagtgaatgtt
aacgggggggcaattgcgttcggccatccgatcggcgcaagcggagccagaatcatcatg
agtttgatatacgaattaaagcggcgcggcggaggtttaggcatagcggcaatatgcagc
ggagcggctcaaggagacgccgtcctgctggaggtgtactga

DBGET integrated database retrieval system