KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2316Help
Entry
BAMF_2316         CDS       T01321                                 

Gene name
yqiK
Definition
(GenBank) putative glycerophosphodiester phosphodiesterase
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAMF_2316 (yqiK)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     BAMF_2316 (yqiK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDPD GDPD_2 PI-PLC-X
Motif
Other DBs
NCBI-ProteinID: CBI43442
Position
complement(2378915..2379652)
Genome map
AA seq 245 aa AA seqDB search
MTTIFAHRGASGDYPENTMLAFTKAIEAGADGIELDVQMTKDGRIVVIHDETLDRTTSLK
GFVKDTAYEKIRTADAAGKWKDSFKGVRIPLLSDVLRFAERADFLINIELKNSVFRYEGM
EEEVIKKVRYYGLEQRVIFSSFNHESLALCHALAPEIERAVLTMDVLYRPERYLASIPAS
GYHPKLGTPAVSAEVIKHLAKHQAALRPFTVNRPEDMKQLIKAGADAFFTDYPKLALSIK
EECCN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacgactatttttgcccaccggggggcgtcgggcgactatcccgaaaatacgatgctc
gcgttcacgaaagcgattgaggccggagctgacggaatcgaacttgacgtacaaatgaca
aaagacggccgaatcgtggttattcacgacgaaacccttgaccgtacgacgtctttgaaa
ggatttgtgaaagatacggcgtatgagaaaatcagaaccgcagatgccgccggcaaatgg
aaagattcgtttaaaggagtcagaattccgcttttgtcagacgtgctgcgttttgcggag
cgtgctgattttctgatcaatattgagctgaaaaacagcgtgttccgttacgagggaatg
gaagaagaagtgatcaaaaaagtcaggtattacggactggaacagcgcgttattttttct
tcatttaatcatgagagcctcgcgctttgccacgccctggcacctgagatagaacgggcg
gtgctgacgatggatgtgctttaccggcctgaacggtatcttgcttcaattccagcttct
ggttatcatccgaagctcggcacgccggcggtcagcgctgaagtgatcaaacatcttgca
aaacaccaagcggcgctccgtccgttcaccgtcaatcggccggaagatatgaagcagctg
ataaaagcgggagcagacgcattttttaccgattatccaaagctggctctttcaataaaa
gaagaatgctgcaactag

DBGET integrated database retrieval system