KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2322Help
Entry
BAMF_2322         CDS       T01321                                 

Gene name
yqiG
Definition
(GenBank) putative NADH-dependent flavin oxidoreductase
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN DHO_dh
Motif
Other DBs
NCBI-ProteinID: CBI43448
Position
2382956..2384077
Genome map
AA seq 373 aa AA seqDB search
MMKQIYKPLFEPFTFESGVTIPNRISVAPMTHYSSNDDGTISDRELSYITPRSKEMGMVI
TACANVTPDGKAFPGQPGIYDDSHIPGLKKLAQAIQSQGAKAVVQIHHGGLECPPELVPN
KDVVSPSGSEEDGRQTSRALTEQEVEHIVKAFGEATRRAIEAGFDGVEIHGANGYLIQQF
YSPKTNQRTDRWGGSDEKRLAFPLAVVDAVKQAIAAHAENPFVLGYRLSPEEPETPGITM
KETFLLADALAEQNLDYLHISLMDVNSKARRGADTSRTRMDLLNERVGHKVPLMAVGSIY
TADEALAVLESGIPLVALGRVILINPEWSVLIKEGREQEIEKAIKASEIEKYRLPEPLWE
MIQNTGGWVPFEK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacaaatttataaaccgctgtttgaaccttttacgtttgaaagcggcgttacc
ataccaaaccgtatttctgtcgcaccgatgacacactattcatcaaacgatgacggaaca
atttcagaccgtgaattaagctacattactccccgttcaaaagaaatgggcatggtcatt
acggcatgtgcaaacgtaacacctgatggcaaagcgtttcccggccagcccggtatctat
gatgattctcacattcccggcttgaaaaaactcgctcaggcgatccagtctcaaggagcg
aaagccgttgtgcagattcaccatggcggattggaatgccctcctgaactcgtgccaaac
aaagacgtcgtcagcccgagcggctcagaagaagacggcagacaaacttcccgggctctt
actgaacaagaagttgagcacatcgtaaaagcattcggcgaagcgacacgcagagcgatt
gaagccggctttgacggtgttgaaattcacggggcaaacgggtacctgattcaacaattt
tattctccgaaaaccaatcagcgcacagaccgctggggcggaagcgatgaaaaacgcctt
gcgttcccgcttgcagtcgttgacgctgtcaaacaggcgattgctgcacacgctgaaaat
ccatttgttctcggctaccgcctgtcaccggaagagccggaaacacctgggattacaatg
aaagaaaccttcctgctcgccgacgcgcttgcggaacaaaacttggattacctgcatatt
tcactgatggacgtcaattccaaagcccgccgcggcgcagatacttcacgtacacggatg
gatttattaaacgaacgcgttggccataaagtgccgctgatggcggtcggttctatctat
accgcggatgaagcgctagccgtattagaaagcgggattccgctggtggctctgggacgt
gtcattctgatcaaccccgaatggtcggtgctgatcaaagaaggccgcgagcaggaaatc
gaaaaagcaataaaagcatctgaaattgagaaataccgactccctgaaccgttatgggaa
atgatccagaatacaggcggctgggtgccgtttgaaaaataa

DBGET integrated database retrieval system