KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2328Help
Entry
BAMF_2328         CDS       T01321                                 

Gene name
recN
Definition
(GenBank) factor for double strand breaks DNA repair and genetic recombination
  KO
K03631  DNA repair protein RecN (Recombination protein N)
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bao03400]
    BAMF_2328 (recN)
DNA repair and recombination proteins [BR:bao03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BAMF_2328 (recN)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    BAMF_2328 (recN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SMC_N AAA_29 AAA_15 AAA_21 HOOK AAA_22 DUF4164 FlpD IFT57 MutS_V RsgA_GTPase ABC_tran
Motif
Other DBs
NCBI-ProteinID: CBI43454
Position
complement(2388835..2390565)
Genome map
AA seq 576 aa AA seqDB search
MLAELSIKNFAIIEELTISFERGLTVLTGETGAGKSIIIDAVSLLVGGRGSSEFVRYGET
KAELEGLFLLDSGHPVFEVCREQGIDASDDMIVMRRDINAGGKSVCRVNGKLVTIAALRE
IGRLLLDIHGQHDNQLLMEDDKHLELLDKFAGAEAESALQAYREGYDRYMKLLKKVKKLS
ESEQEMAHRLDLIQFQLEEIESAKLELNEDELLQEERKQISNFEKIYESLQNAYNALRSE
QGGLDWVGMASAQLEDISDINEPLQKLSETVSSSYYLLEDATFQMRNLLDDLEYDPERLN
FIETRLNEIKQLKRKYGATVEDILEYGSKIEEEIDQIENRDSHLETLKKELESVGKDVAV
EAANLSKIRKAWAKKLAEAIHQELKSLYMGKSTFDTEFLVKTDPSADEAPVVNGQPVQLT
QKGIDLVKFLISTNTGEPLKPLSKVASGGELSRVMLAIKSIFSSQQDVTSIIFDEVDTGV
SGRVAQAIAEKIHKVSTGSQVLCITHLPQVAAMADTHLLIAKELKDGRTTTHVTPLSQQD
KVAEIGRMIAGVEVTDLTKRHAKELLKQAGQVKTTG
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
ttgttagctgaactatcaataaaaaactttgccattatagaggaactgacgatctcgttt
gaacgggggctcaccgtcctgacgggagaaacaggagccggcaagtcaattattatagac
gccgtttccctgttagtcggcggccgcgggtcgtctgaatttgtccgttacggtgaaaca
aaggccgagcttgaaggactgtttcttttagacagcggccatcccgtttttgaggtgtgc
cgtgagcagggaatagacgcatctgacgacatgattgtcatgagaagggacatcaatgcc
ggaggaaaaagcgtctgccgtgtcaacggaaaattagtaacgatcgcggctttaagggag
atcggcagacttttattagatattcacggacagcatgataaccagctgttaatggaggac
gacaagcatttagagcttttagataaatttgcgggcgctgaggccgaatcagcgcttcag
gcttaccgtgaaggctatgaccgttatatgaagctgctcaaaaaagtgaagaagctgtca
gagagcgagcaggaaatggcgcatcggttagatctgatccaatttcagcttgaagaaatc
gaatcggctaagcttgaattgaatgaagacgagcttcttcaggaagaacggaagcaaata
tccaactttgagaaaatttatgaatcattgcaaaacgcctataatgcgctccgcagtgag
caggggggtctcgactgggtcggaatggcttctgcccagcttgaagacatttcggatatc
aatgaaccgctgcaaaagctgtccgaaactgtgtcaagttcctattatctgctggaagat
gcaacctttcagatgcgcaatttgttagatgatctggaatatgatccggaacggctgaat
tttattgaaacccgtttaaacgagattaaacagctgaagcgcaaatacggagcgacggta
gaagatattctggaatacggctcaaagatagaagaggaaattgatcaaatcgagaaccgt
gacagccaccttgaaacgctgaagaaggaactggagtccgtgggcaaagatgtggccgta
gaagccgccaacttatcaaaaatcagaaaagcatgggccaaaaaactggctgaagcgatt
catcaggaattaaaaagtctgtatatgggcaaatctacgtttgatacggaatttcttgtg
aaaaccgatccgtcagccgatgaagcgccagttgtcaacggccagcccgtgcagcttacc
caaaagggcattgaccttgtgaaatttttaatttcaacaaataccggtgagcctctcaag
ccgctgtcaaaggttgcgtccggcggcgaactttcaagggtgatgctggcgataaagagt
attttttcttctcagcaggatgtcacttccatcatctttgacgaagtggacaccggtgta
agcgggcgggttgcgcaggccatcgcggaaaaaatccataaagtatctaccggttcacag
gtgctctgcattacacatctcccgcaggttgccgccatggcggacacgcaccttttgatc
gcgaaagaattaaaagacggccggacgacgacgcatgtcacgccgctttcccagcaggac
aaggtagcggaaatcggccgcatgattgcgggcgtcgaagtgacagatctgacaaaacgg
catgcaaaagagcttttaaaacaggccggacaggtaaaaacgacaggataa

DBGET integrated database retrieval system