KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2331Help
Entry
BAMF_2331         CDS       T01321                                 

Gene name
dxs
Definition
(GenBank) 1-deoxyxylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00730  Thiamine metabolism
bao00900  Terpenoid backbone biosynthesis
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01130  Biosynthesis of antibiotics
Module
bao_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BAMF_2331 (dxs)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAMF_2331 (dxs)
Enzymes [BR:bao01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     BAMF_2331 (dxs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C Transketolase_N TPP_enzyme_C PFOR_II E1_dh DUF987
Motif
Other DBs
NCBI-ProteinID: CBI43457
Position
complement(2391985..2393886)
Genome map
AA seq 633 aa AA seqDB search
MDLLSIQDPSFLKKMSIEQLEELSEEIRNFLITSLSASGGHIGPNLGVVELTIALHKEFD
SPKDKFLWDVGHQSYVHKLLTGRGKEFETLRQYKGLCGFPKRSESEHDVWETGHSSTSLS
GAMGMAAARDIKGTKEYIIPIIGDGALTGGMALEALNHIGDEKKDMIVILNDNEMSIAPN
VGAIHSMLGRLRTAGKYQWVKDELEYLFKRIPAVGGKLAATAERIKDSLKYMLVSGMFFE
ELGFTYLGPVDGHSYHELIENLQYAKKTKGPVLLHVITKKGKGYKPAETDTIGTWHGTGP
YKINTGDFVKPKAAAPSWSGLVSGTVQELAREDDRIVAITPAMPVGSKLEGFAKEFPERM
FDVGIAEQHAATMAAGMALQGMKPFLAIYSTFLQRAYDQVVHDICRQNANVFIGIDRAGL
VGADGETHQGVFDIAFLRHIPNLVLMMPKDENEGRHMVNTALSYEEGPIAMRFPRGNGLG
VKMDKELKSIPIGTWEVLRPGKDAVILTFGTTIEMALEAAEELQKEGLSVRVVNARFIKP
IDKQMMKAILNEGLPILTIEEAVLEGGFGSTILEFAHDLGMYHTPIDRMGIPDRFIEHGS
VTALLEEIGLTKAEVMNRIKLLMPPKTHKGIGS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
ttggatcttttatcaatacaggacccgtcatttcttaaaaagatgtcaattgaacagctg
gaagagctgagtgaggagatccgcaattttctcattacatcgctgtctgcctcagggggc
catatcgggccgaacctcggggttgtcgagctgacaattgcgcttcacaaagaatttgac
agtccgaaggataaatttttatgggatgtcggacatcagtcctatgttcacaaactgtta
accggacgcggcaaggagtttgaaaccttgcgccaatataaagggctttgcggtttcccg
aaacgcagcgaaagcgaacacgacgtatgggaaacaggccacagctcaacatcgctctca
ggggcgatgggaatggctgccgcccgtgatattaaagggacgaaagaatatatcatcccg
attatcggagacggggctttaaccggaggaatggcgcttgaagcgctgaaccatatcggc
gatgagaaaaaagacatgatcgtcatcctgaatgataatgagatgagcattgcgccgaat
gtcggggcgattcattctatgctgggcaggcttcgcacggccggcaaataccaatgggta
aaagacgagcttgaatatttatttaagcgcatcccggccgtcggcggaaaattggccgcc
acagcggaacggataaaagacagcttaaaatatatgcttgtgtcaggcatgttttttgaa
gagctgggctttacgtatttaggcccggttgacggtcattcctatcacgaactgattgaa
aacctgcaatacgccaaaaaaacgaaaggtcctgtccttttacatgtcatcacgaaaaag
ggcaaaggctataaaccggctgaaaccgacacgatcggcacatggcacgggacgggtccg
tacaaaatcaatacgggcgatttcgtcaaaccgaaagccgcggcgccttcatggagcggg
cttgtcagcggcaccgtgcaggagctggcgcgtgaggatgacagaattgtcgcgattaca
ccggccatgcctgtcggctctaagctggaagggtttgcgaaagaatttcctgagcgcatg
tttgacgtcggaatcgcagaacagcatgcggcgacaatggccgcgggaatggcgcttcag
ggcatgaagccgtttcttgcgatttattcgacctttttgcagcgggcctacgatcaggtc
gtccatgacatctgccgtcaaaacgcgaatgtatttatcggcattgaccgggccggtttg
gtcggtgctgacggggagacgcatcaaggcgtctttgatattgcctttttgcgtcatata
ccaaacctcgttttgatgatgccgaaagatgaaaatgaaggccgccatatggtcaataca
gcccttagctatgaagaaggtccgattgcgatgcgcttcccgcgcggaaacggactcggc
gtaaagatggataaagagctgaaaagcattccgatcggaacatgggaagtgctccgtccc
ggaaaagacgcggttattttaacattcggaacaacgattgagatggcgcttgaagcagct
gaagaactgcaaaaagaaggcctgtccgtgcgtgtcgtcaatgcgcggttcataaaaccg
attgataaacaaatgatgaaggcgattcttaatgaaggtcttccgattttaacgattgaa
gaagccgtgcttgaaggcggattcggaagcacgattcttgaattcgctcatgacctcggc
atgtatcatacgccgattgacagaatgggcatccctgaccggtttattgagcacggaagc
gtaaccgccctgcttgaagaaatcggtctcacgaaggctgaggttatgaaccggattaaa
ctgctgatgccgccgaagacacataaaggaattggatcatga

DBGET integrated database retrieval system