KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2336Help
Entry
BAMF_2336         CDS       T01321                                 

Gene name
nusB
Definition
(GenBank) transcription termination factor NusB
  KO
K03625  N utilization substance protein B
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bao03021]
    BAMF_2336 (nusB)
   03009 Ribosome biogenesis [BR:bao03009]
    BAMF_2336 (nusB)
Transcription machinery [BR:bao03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BAMF_2336 (nusB)
Ribosome biogenesis [BR:bao03009]
 Prokaryotic Type
  rRNA transcription factors
   BAMF_2336 (nusB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NusB
Motif
Other DBs
NCBI-ProteinID: CBI43462
Position
complement(2397493..2397885)
Genome map
AA seq 130 aa AA seqDB search
MKRRTAREKALQALFQIDVSDIAPNEAIEHALDGEKTDAFFEQLVYGVIEHQVQLDEMIS
GHLVNWKLDRIANVDRAILRLAVYEMVYTDDIPANVSLNEAIELAKRFGDDKAAKFVNGV
LSNIKTDIES
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagaacagctagagaaaaagctttgcaggcactttttcagattgatgtcagc
gatattgcaccgaacgaggccattgagcacgcgcttgatggtgagaaaacagatgccttc
tttgaacagctggtgtacggagtgatcgaacatcaggtacagcttgatgaaatgatttcc
ggccatcttgtcaattggaagcttgaccggattgcaaacgtagaccgcgcgatcctgcgt
ctggcggtgtatgaaatggtttatactgacgacattcctgctaacgtgtcattaaacgaa
gcaatcgagctggcaaaacggttcggcgacgataaagctgcaaaattcgtaaacggggtt
ctttctaacattaaaactgatatcgaatcgtag

DBGET integrated database retrieval system