KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2341Help
Entry
BAMF_2341         CDS       T01321                                 

Gene name
spoIIIAG
Definition
(GenBank) stage III sporulation engulfment assembly protein
  KO
K06396  stage III sporulation protein AG
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BAMF_2341 (spoIIIAG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2157 DUF4834
Motif
Other DBs
NCBI-ProteinID: CBI43467
Position
complement(2401247..2401984)
Genome map
AA seq 245 aa AA seqDB search
MRKLRFIWKAGRKTAMNKNGLWNILKKQLMIGQAKDGEKPKLTKYHYFLFVFVLGVSFML
VSQMFSSPEKTGKDQTAQTVMSGQTEDKSGQKSAPVFKASKDSSAKNTIDDYERDYENQL
KEILETIIGVEDVSIVVNVDATSLKVFEKNKTKKDTTTEETDKEGGKRSVTDQTSEEQIV
MIRNGDQETPVVVQTKKPDIRGVLVVAQGVDNVQIKKTIIDAVTRVLDVPSYRVAVAPKK
IKEDS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaattacggtttatatggaaggcggggagaaaaacggccatgaataaaaacgga
ctatggaacatactcaaaaaacagctgatgatcggacaggcgaaagacggagaaaaacca
aaactgacaaaatatcattactttctgttcgtgtttgtgctcggggtatcttttatgctg
gtcagccagatgttctcttcacctgagaaaaccgggaaggaccaaacggcgcagactgtc
atgtccggccaaacggaagacaagagcgggcaaaaaagcgcacccgtttttaaggcgtca
aaagacagcagcgccaaaaacacgatcgatgattacgagagagattatgaaaaccagctg
aaagaaatccttgaaacgattatcggcgtggaggatgtatcgattgtcgtaaacgtagac
gcgacatcgttaaaagtgtttgaaaaaaataaaacgaaaaaagacaccactactgaagaa
accgataaagaaggcggcaaaagaagcgtaaccgatcaaacctctgaagaacaaattgtc
atgatccgaaacggggaccaggaaaccccggtcgtcgttcagacgaaaaagcctgatatc
cgcggtgtactcgttgtcgctcagggagtggacaacgttcaaataaaaaaaaccatcatt
gatgccgtcacaagggtgcttgatgttccgagctaccgtgtagcggttgcccctaaaaaa
atcaaggaggattcataa

DBGET integrated database retrieval system