KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2346Help
Entry
BAMF_2346         CDS       T01321                                 

Gene name
spoIIIAB
Definition
(GenBank) stage III sporulation protein
  KO
K06391  stage III sporulation protein AB
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_III_AB
Motif
Other DBs
NCBI-ProteinID: CBI43472
Position
complement(2404435..2404950)
Genome map
AA seq 171 aa AA seqDB search
MLKLLGAVFILTATTWTGFEIAKIYIERPRQIRQLRAALQSLEAEIMYGHTPLHTASGHI
ARQLSKPVSLLFQAFSQRLEQGSDSAKTAWEQSLKHNWPSMAMKKSEYDVLKQFGETLGL
HDRVSQQKHIKLALTHLEAAEADAGRAQAKNEKMVKSLGFLAGLLLILLLM
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcttttgggggccgtgttcattctgacggcgacgacatggacgggatttgag
atcgccaaaatctatattgaaaggccgaggcagatccgtcagctgcgtgcggcgctgcaa
tcgcttgaagcggaaattatgtacggacatacgccgctgcacaccgcctcgggacacatc
gccagacagctttccaaacctgtgtcactattgtttcaagctttcagccaaaggcttgaa
cagggaagcgattccgccaaaacggcctgggaacagagcctgaagcataactggccttcc
atggcgatgaaaaaaagcgaatatgatgtgctgaagcaattcggagagacgctcgggctt
catgaccgggtttctcagcagaaacatatcaagcttgcgcttacacatttggaagcggcg
gaagcggatgccggacgggcgcaggcgaaaaatgaaaaaatggtgaaaagtttaggattt
ttagccggactgttactcattcttctattgatgtaa

DBGET integrated database retrieval system