KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2347Help
Entry
BAMF_2347         CDS       T01321                                 

Gene name
spoIIIAA
Definition
(GenBank) ATP-binding stage III sporulation protein
  KO
K06390  stage III sporulation protein AA
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BAMF_2347 (spoIIIAA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTPase_1 AAA AAA_22 AAA_14 AAA_30 TniB AAA_28 AAA_16 AAA_18 AAA_25 T2SSE FtsK_SpoIIIE AAA_11 AAA_5 AAA_24 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: CBI43473
Position
complement(2404944..2405867)
Genome map
AA seq 307 aa AA seqDB search
MNEITEVLPELLRHAISAVPEETWRDTEEIRIRVDRPVELIRKGQPLFLSYICTAGDAQL
ILSRLSNYSMYTLEEELKKGYITIRGGHRVGLAGRVIVENGAVKGLRDITSFNIRIAREK
LGIAEPLIPFLWKENWLNTLIIGPPQTGKTTLLRDLARLSSTGSKRIPAKKTGIIDERSE
IAGCLRGIPQHSFGRRVDVLDACPKAEGLMMMIRSMSPDVMIVDEIGRIEDSEALMEALH
AGVSVIVSAHGWNMKDLVKRPSLKMLWEEKVFDRYVELSRRRGPGTISRMYGKDGEQLPH
AESVMTC
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgaaattacagaggttctccctgaattattgagacatgccatctccgccgtacca
gaagaaacatggcgggatacagaagaaatcaggatacgggtcgacaggccggttgaactg
atccggaaaggacaacctttgtttttgtcatatatctgtacggccggcgacgcacagctg
atcctcagccggctcagcaattacagtatgtacacgctggaagaagagctgaaaaaagga
tatatcacaatcagaggaggccatcgggtggggctggccggaagagtcatcgtcgaaaac
ggagccgtcaaagggctccgggatattacgtcttttaatattcgaatcgcccgggagaag
cttggaatcgcagaaccgcttattcctttcttatggaaagaaaactggctgaacacactc
atcatcggccctccgcaaacaggaaaaacgaccttgcttcgtgatttggcccggctttcc
agcaccggatcgaaacgcattccggcgaaaaagaccggtatcattgatgagcggtcggaa
attgccggctgcctgcggggcattccccagcacagtttcggccgcagagttgatgtcctt
gatgcctgtccgaaggcagaagggctgatgatgatgatccgctctatgagtcctgatgtc
atgatcgtggatgagatcgggagaatagaagactctgaagcgctgatggaagcgctccat
gcgggtgtatcggttatcgtatctgcgcacggatggaatatgaaagatttggtgaaaaga
ccgtcgctgaaaatgctttgggaggaaaaagtgtttgaccggtatgttgaactgtcaagg
cgccgcggtcccggcacgatcagcaggatgtacggaaaggacggggagcagctgccgcat
gctgaaagcgtgatgacatgctga

DBGET integrated database retrieval system