KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2350Help
Entry
BAMF_2350         CDS       T01321                                 

Gene name
yqhT
Definition
(GenBank) putative aminopeptidase
  KO
K01262  Xaa-Pro aminopeptidase [EC:3.4.11.9]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bao01002]
    BAMF_2350 (yqhT)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.9  Xaa-Pro aminopeptidase
     BAMF_2350 (yqhT)
Peptidases [BR:bao01002]
 Metallo Peptidases
  Family M24
   BAMF_2350 (yqhT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M24 Creatinase_N Germane
Motif
Other DBs
NCBI-ProteinID: CBI43476
Position
complement(2406955..2408016)
Genome map
AA seq 353 aa AA seqDB search
MKLEKLRNLFGQLDIDGILVTSSANLQYMTGFTGSSGLAVISKERAAFITDFRYTEQAKA
QVKGFEIIEHGGSLIQTAADTILEYGIKKLGFEQNSLTYGTYASYQAVLQEAEMVPVADS
VEKLRLIKSSEEIKILEEAAKIADDAFEHILTFIKPGISEISVANELEFYMRRQGADGSS
FDMIVASGVRSSLPHGVASGKLIEKGDLVTLDFGAYYKGYCSDITRTVAVGEPSDKLKEI
YQVVYDAQALGVSHIKPGMTGKEADALTRDHITAKGYGQYFGHSTGHGFGMEVHESPGLS
FRSSAVLEPGMAVTVEPGIYIPEVGGVRIEDDIIITEDGNRTITHSPKELIIL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgagaaattgcgaaatcttttcggtcagctcgatatagacggaatcttggtg
acaagctccgccaatctgcagtatatgacgggatttacgggttcgtcaggcttggcggtc
atatcgaaagaacgtgcggcatttattacggatttccgttacaccgagcaggcgaaggcg
caagtgaagggctttgaaattatcgagcacggcggaagcttaatccaaacggctgcggac
acgattcttgagtacggcattaaaaaactcggcttcgaacaaaacagcctgacgtacgga
acatatgcatcctaccaagcggtgctgcaagaagcggagatggttcccgtcgcggattcc
gttgaaaagttgcgcttgattaagtcaagtgaagagattaagatattagaggaagctgcg
aagattgcggatgatgcgtttgaacatattctgacgtttatcaaacctggcatctcagag
atttcagtcgcaaacgagcttgaattttatatgagacgtcaaggagcagatggctcttcc
tttgatatgatcgtcgcctcaggagtcagatccagccttccgcacggagtggcaagcggc
aaattgattgaaaagggagacttggtcacgctcgatttcggcgcttattataaaggctat
tgttctgatatcacacgcaccgtcgcggtcggagagccaagtgataaactgaaagaaatt
tatcaggtcgtatacgatgcccaggcgctcggtgtttcgcatattaaacccggcatgacg
ggaaaagaagcggatgccctgacgagggatcacatcaccgcaaaaggctacggacagtat
ttcggccattcaacaggacacgggttcggaatggaagtccatgaatccccgggactgtct
ttcaggtcatcggccgttcttgagccgggcatggcggtaacggttgagccgggcatatac
ataccggaagttgggggcgtcagaatcgaagatgatatcatcatcactgaggacggcaac
cggacaattacgcattcccctaaagaattaattattttgtga

DBGET integrated database retrieval system