KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2353Help
Entry
BAMF_2353         CDS       T01321                                 

Gene name
yqhP
Definition
(GenBank) conserved hypothetical protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MscL Chordopox_A13L NEMP MscS_TM SPC25
Motif
Other DBs
NCBI-ProteinID: CBI43479
Position
2409891..2410286
Genome map
AA seq 131 aa AA seqDB search
MNHRVQPFFAVLIALGAFGFIYAAVTNPGQMISRAITVIIAGVIIYFIVRSVLNRRAGRD
GTAFKKAAKQSRLRMKEQKAKHRAAHRGRVSHLRSVPSSSRPKPMILKKKSQTQLTVIEG
KKNKKKNRALF
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatcgtgtacaacctttttttgctgtattaatagcgcttggtgcatttggtttc
atttatgcggcggtaacaaaccccgggcagatgatctcaagagcgattaccgtcattatc
gcaggcgtcatcatttattttatcgtgagatcggttctgaaccgccgcgccggccgtgac
ggaaccgctttcaaaaaagcggccaaacaatcgcggctccgaatgaaggagcaaaaagcg
aagcatcgcgccgctcacagagggcgggtcagccatttgcggagcgtgccgagcagcagc
agaccgaagccgatgattcttaagaaaaaaagccagacccagcttaccgtcatagaaggt
aaaaagaataaaaagaaaaacagagcgcttttttaa

DBGET integrated database retrieval system