KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2354Help
Entry
BAMF_2354         CDS       T01321                                 

Gene name
yqhO
Definition
(GenBank) conserved hypothetical protein
  KO
K07001  NTE family protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BAMF_2354 (yqhO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Patatin
Motif
Other DBs
NCBI-ProteinID: CBI43480
Position
complement(2410283..2411158)
Genome map
AA seq 291 aa AA seqDB search
MQIDGVFSGGGIKGVALAGAYEALEEKGYCFERLAGTSAGAIIAAFIAAGYTSREVHSII
DEVDGRQLLDQRYSFLPLNILQWVSIYWRLGLYKGDTLEKWIADKLKAKGIIAFGDMKKG
SLRLIASDLTNGTMIVLPDDLPRYGLNPEMFPVARAVRMSCSIPYFFEPIKLKTDKGTST
VVDGGVLSNFPIWLFSKERRRPVIGISLSPNEKERPKNSIRNAFELFGALFETMKDAHDA
RHIATKYEQNIIFIPVENVMATEFHLTPQKKLALIELGKSRTEQFLKQWSY
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgacggcgtattttcgggcggggggataaaaggggtggcgcttgccggcgcg
tatgaagcgcttgaagaaaagggctattgttttgaaagactcgccggaacaagcgccggc
gcgattattgccgcatttatcgctgcgggctacacgagcagagaggttcattccatcata
gatgaggtggacggaagacaattgcttgatcagagatattccttcctcccgctgaatatc
ctgcagtgggtgtcgatatattggcgccttggattatacaaaggcgatacgctggaaaaa
tggattgcggataaattaaaagcgaagggcatcatcgcgttcggcgatatgaaaaaagga
tcgctccgtctgatcgcttcagatctgacgaacggaacgatgatcgtgcttcctgacgac
cttccccgctacggattaaatccggagatgttcccagttgccagagctgtcagaatgagc
tgcagcatcccttatttttttgagccgattaaactgaagactgataaaggcacctcaacg
gtcgttgacggcggcgtgctaagcaatttcccgatttggctgttttccaaagagcgcagg
cggccggtcatcggaatttcgctttcgcctaacgaaaaagagcgcccgaaaaactcaatc
cgcaacgcttttgagctgttcggcgctttgtttgaaacgatgaaagacgctcatgatgcc
aggcatatcgcgacgaagtacgaacagaatattatttttattccggtggaaaatgtgatg
gcgacggagtttcatctcacaccgcaaaaaaaactagctctcattgagctaggaaaaagc
agaacagagcaatttttgaagcaatggagctattaa

DBGET integrated database retrieval system