KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2358Help
Entry
BAMF_2358         CDS       T01321                                 

Gene name
gcvPB
Definition
(GenBank) glycine decarboxylase (subunit 2) (glycine cleavage system protein P)
  KO
K00283  glycine dehydrogenase subunit 2 [EC:1.4.4.2]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00260  Glycine, serine and threonine metabolism
bao00630  Glyoxylate and dicarboxylate metabolism
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01130  Biosynthesis of antibiotics
bao01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BAMF_2358 (gcvPB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAMF_2358 (gcvPB)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     BAMF_2358 (gcvPB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDC-P Aminotran_5 Beta_elim_lyase Pyridoxal_deC Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CBI43484
Position
complement(2413260..2414735)
Genome map
AA seq 491 aa AA seqDB search
MNNQDQTLIFEMSREGRVGYSLPELDVPETELESLLPGDYIRNEDAKLPEVSELDIMRHY
TALSKRNHGVDSGFYPLGSCTMKYNPKLNEKIARFPGFSAIHPLQDEDTVQGALELLYDL
SGHLEEITGMDEVTLQPAAGAHGEWTGLMMIRAYHEARGDFGRTKVIVPDSAHGTNPASA
TVAGFETITVKSNEHGLVDIEDLKRAVNEETAALMLTNPNTLGLFEENITEMADIVHQAG
GKLYYDGANLNAVLSKARPGDMGFDVVHLNLHKTFTGPHGGGGPGSGPVGVKKEFIPYLP
KPVLTKKEGRLTFDYDRPQSIGRVKPYYGNFGINVRAYTYIRSMGPDGLKAVTENAVLNA
NYMMRRLAPYYDLPYARHCKHEFVLSGRRQKKLGVRTLDIAKRLLDFGYHPPTVYFPLNV
EESIMIEPTETESKETLDAFIDAMIQIAREAEESPETVQEAPHTTVVKRMDETKAARKPV
LKYEHTSAGSR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcaagatcagacgcttatttttgaaatgtcccgcgaagggcgtgtcggttac
agccttccggagcttgatgtaccggaaacggagcttgaaagccttcttccgggtgattat
atccgcaatgaagacgcaaagcttccggaagtatcagagcttgatattatgcggcattat
accgcactttctaagagaaaccacggggttgattcaggtttttatccgctcggctcctgt
acgatgaaatacaatccgaaattaaatgaaaaaattgcccggttcccaggcttttcagcc
attcacccgcttcaggacgaggacacggttcagggagcgcttgagcttttatacgattta
agcggacacttggaggaaattacgggtatggacgaggtgacgctgcagcctgcggcgggc
gctcacggcgaatggaccggcctgatgatgatccgcgcttatcatgaagcacggggagac
ttcggacggacgaaggtgattgttcccgattctgcccacgggacgaatccggcatccgcc
acggtcgccggctttgaaacgattaccgtcaagtcaaatgaacacgggctggttgacatt
gaagatttgaaaagagcggtaaatgaagaaacagcggcgctgatgctgacgaatccgaac
accctcggcttatttgaggaaaatattacagaaatggctgatatcgtccatcaggccggc
ggaaagctttattatgacggagcgaatttaaacgccgttttaagtaaagcaagaccggga
gatatgggatttgacgtcgttcatcttaatctgcataaaacatttaccgggccgcacggc
ggaggaggaccaggctcgggcccggtcggagtaaagaaagaattcattccgtacctgccg
aaacccgtcctcacgaaaaaagagggccgtttgacttttgactatgaccgtccgcaatcg
atcgggcgcgtaaagccttattacggaaacttcggcattaatgtcagagcctacacgtat
atccgctccatggggcctgacggcttaaaagctgtgaccgaaaacgcggttttaaatgca
aattatatgatgagaagactcgcgccttattatgatctgccgtatgcccgtcattgcaag
catgaatttgtgttatcgggaagaagacagaaaaagctcggcgtaagaacgcttgatatt
gccaaacggcttttagatttcggctatcacccgccgactgtgtatttccctctcaatgtg
gaagaaagcatcatgatcgaaccgacggaaacggaatcgaaggaaacgcttgatgccttt
atagatgccatgattcaaattgcgcgggaagcggaggaatcacctgagaccgttcaggag
gcgccgcataccacggttgtcaaaagaatggatgaaaccaaggccgcaagaaagccggtt
ttaaaatacgaacatacatctgccggcagccgctga

DBGET integrated database retrieval system