KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2360Help
Entry
BAMF_2360         CDS       T01321                                 

Gene name
gcvT
Definition
(GenBank) aminomethyltransferase (glycine cleavage system protein T)
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00260  Glycine, serine and threonine metabolism
bao00630  Glyoxylate and dicarboxylate metabolism
bao00670  One carbon pool by folate
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01130  Biosynthesis of antibiotics
bao01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BAMF_2360 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAMF_2360 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BAMF_2360 (gcvT)
Enzymes [BR:bao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     BAMF_2360 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG TrmE_N
Motif
Other DBs
NCBI-ProteinID: CBI43486
Position
complement(2416089..2417189)
Genome map
AA seq 366 aa AA seqDB search
MLKRTPLYDVYKEYGGKTIDFGGWELPVQFSSIKEEHEAVRTKAGLFDVSHMGEVEVSGQ
DALSFLQKMMTNDVADLKPKSALYTAMCYPDGGTVDDLLIYQKSETCYLLVINASNIEKD
LAWLKEHAKGDVTLTNQSDEISLLAVQGPNAQTVLSKLTECDLASLKPFTFIDEADVAGR
QVLLSRTGYTGEDGFELYCRNGDAVHLFKEILAAGENEGLVPCGLGARDTLRFEAKLALY
GQELTKDITPIEAGIGFAVKHKKDSDFFGKSVLSEQKEKGAPRKLVGLEMIEKGIPRHGY
AVKKDGVAIGEVTTGTQSPTLKKNIGLALIKTEFSEIGTEVEVEIRKKTVKAKIVRTPFY
KRPKQS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaacgaacaccgctttatgacgtatataaagaatacggcggaaaaacgattgat
tttggaggatgggagctgcctgttcaattttcttctattaaagaggagcatgaagccgtc
cgcacaaaagcgggcctgtttgatgtgtcccatatgggagaagtcgaagtatccgggcaa
gacgccctgtcttttctgcaaaaaatgatgacaaatgacgttgccgacttaaagccgaaa
agcgcgctttataccgccatgtgttatcccgacggaggcacggtcgatgacttgctgatc
tatcagaaaagcgaaacctgctatctgctcgtaatcaatgcgtctaatattgaaaaagac
ctcgcttggctgaaggaacatgcaaaaggggatgtcacattaacgaatcagtctgacgag
atttcactgcttgccgttcagggaccgaatgctcagacggttctttcgaagctgactgaa
tgtgatttggcttccttaaagccgtttacgtttattgatgaggcggacgttgccggacgc
caagtcctgctttcaagaacgggatataccggtgaagacgggtttgagctttattgccgc
aacggagacgcggttcatctttttaaagagattcttgcagcgggagagaatgaagggctc
gttccgtgcggtctcggcgcccgtgatacgctgagatttgaagcgaagctcgctttatac
ggtcaggaattgacgaaagacattacgccgatcgaagccggaatcggatttgccgtaaag
cacaagaaagattccgatttttttgggaagtctgtattgagtgaacagaaagaaaaagga
gctccgcgtaagctggtcgggcttgagatgattgaaaaagggattccgagacacggatac
gccgtaaaaaaagacggtgttgcaatcggtgaagtcacgacaggcacacaatctccgact
ttaaagaaaaatatcggccttgccttaatcaaaacggaattcagtgaaatcggaacggaa
gtagaagtggaaatccgcaaaaaaacggtaaaagcgaagattgtccgcacaccgttttat
aaacgtccaaaacagagctga

DBGET integrated database retrieval system