KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2363Help
Entry
BAMF_2363         CDS       T01321                                 

Gene name
sinI
Definition
(GenBank) antagonist of SinR
  KO
K06372  antagonist of SinR
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BAMF_2363 (sinI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SinI MerR-DNA-bind Seryl_tRNA_N SelB-wing_1 MerR_1 YabB
Motif
Other DBs
NCBI-ProteinID: CBI43489
Position
2420278..2420451
Genome map
AA seq 57 aa AA seqDB search
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgcaaaaacagagttttcgcaattagataaggaatgggttgaactgatatta
gaagcccaaaaagcaaatatcagcctagaagagatacgcaaatacctgcattcgcataaa
aagtcttctcaacatatccaggccgccagaagtcataccgtaaatcctttctga

DBGET integrated database retrieval system