KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2364Help
Entry
BAMF_2364         CDS       T01321                                 

Gene name
sinR
Definition
(GenBank) transcriptional regulator for post-exponential-phase response
  KO
K19449  XRE family transcriptional regulator, master regulator for biofilm formation
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bao03000]
    BAMF_2364 (sinR)
Transcription factors [BR:bao03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    BAMF_2364 (sinR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 SinI HTH_19 HTH_31 HTH_26 HTH_25 HTH_37 Sigma70_r4 KorB HTH_10 GH-E CdhC HTH_35
Motif
Other DBs
NCBI-ProteinID: CBI43490
Position
2420479..2420820
Genome map
AA seq 113 aa AA seqDB search
MTLIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSV
HTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLEYQKWRKAQKEE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgacattgattggccagcgtattaaacaataccgaaaagaaaaaggctactcactatca
gaactagctgaaaaagctggggtagcgaagtcttatttaagctcaatagaacgaaattta
cagacgaacccctccattcaatttctagaaaaagtctccgctgttctggacgtctcggtt
catacattacttgatgaaaaacatgaaaccgaatacgatggtcaattagatagtgaatgg
gagaaattagttcgcgatgcgatgacatccggggtatcaaaaaaacaatttcgtgaattt
ttagaatatcaaaaatggagaaaagcgcaaaaagaggagtag

DBGET integrated database retrieval system