KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2365Help
Entry
BAMF_2365         CDS       T01321                                 

Gene name
tasA
Definition
(GenBank) major biofilm matrix component
  KO
K06336  spore coat-associated protein N
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
Peptidases [BR:bao01002]
 Metallo Peptidases
  Family M73
   BAMF_2365 (tasA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M73 YSIRK_signal
Motif
Other DBs
NCBI-ProteinID: CBI43491
Position
complement(2420868..2421653)
Genome map
AA seq 261 aa AA seqDB search
MGMKKKLSLGVASAALGLALVGGGTWAAFNDVKSTDATFASGTLDLSAKEQSANVNLSNL
KPGDKLTKDFEFRNNGSLAIKEVLMALNFTDFKGAKKGNESAEDFLSQFEITVLTVGKEG
GNGYPKNIILKAASLKDLYLMSAKQDKAAAEAISKHIDPKFLSESGKVNVATINGKTAPE
YDGVPKTPVDYDQVRMEIRFKNDTAKDANGLSVQNKFQGNAISLQFSFEATQWNGLTITK
DHTDKDGYVKENEKAHSEDKN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgaaaaagaaattaagcttgggcgttgcctcagccgcactcggtttagcatta
gtaggaggaggcacatgggccgcatttaatgatgtgaagtccacggacgccacatttgcg
tcaggaacacttgatttatcggctaaagaacaatcagccaatgtcaatttgtcaaactta
aaaccaggcgacaaattgacaaaagattttgaattcagaaacaacggttcacttgccatt
aaagaagtgctgatggctttgaactttactgacttcaaaggagcaaagaaaggaaacgaa
tctgcggaggatttcctcagccagtttgaaattacggttctgacagtcggtaaagaaggg
ggcaacggctaccctaaaaatatcattttgaaggcggccagcctgaaagacttatactta
atgtctgcaaagcaggataaagcagcggctgaagcgatcagcaagcatattgatccgaag
ttcttgagtgagagcggaaaagtcaatgtagcaaccattaacggcaaaacagcgcctgag
tacgacggagttccgaaaacgcctgttgattatgatcaagtgcggatggaaatccgattt
aaaaatgataccgcaaaagacgcaaacggtctgagtgtccaaaacaaattccagggcaat
gcgatttctcttcaattctcatttgaagcaacgcaatggaacggattgaccattacgaaa
gaccatacggataaagacggttacgtgaaggaaaatgaaaaggctcatagtgaggataaa
aactga

DBGET integrated database retrieval system