KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2367Help
Entry
BAMF_2367         CDS       T01321                                 

Gene name
yqxM
Definition
(GenBank) lipoprotein for biofilm formation
  KO
K19433  TasA anchoring/assembly protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99993 Cell motility
    BAMF_2367 (yqxM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CBI43493
Position
complement(2422274..2422945)
Genome map
AA seq 223 aa AA seqDB search
MFRLLRPEKKGKVRSRMMLFLRLSFIFCLPVTICTQFTGDTSSSFNDVKSFSLPVQTCGD
FRYTDDNCRYDERWDQSDLHITNQTDTSGTVCAPLQLYAELENRGKERTVSDWKWELHKI
ASQQQPLQNGNVVDKGLITDKKSKTIYKMESKRALQPGIYAFKVYKPEGYPANEEKFEWS
KPMKLVKCQEQATASDQKKTEKKPAEPAKESGEEHEKNTETDQ
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgttccgattgttgcgaccggaaaaaaagggcaaggtgagatcgagaatgatgctgttt
ttacggctgtcgttcattttctgcctgcccgtgacgatatgtactcagtttacgggagac
acaagttcctcctttaatgatgtgaaaagcttcagtctcccggttcaaacgtgcggagat
tttcgatatacagatgacaattgccgttatgacgaacgctgggatcaaagtgatttacat
atcacaaatcaaactgatacgtcaggcaccgtgtgtgcgccgcttcaactttatgcggag
ctggagaacagggggaaagagcggactgtttctgactggaaatgggagctccataaaatt
gcctctcagcaacagcctttacaaaacggcaatgtcgtggataaagggcttattactgat
aaaaaaagcaaaacgatttataaaatggagtcaaagcgggccttgcagccgggaatttat
gcattcaaggtttacaagcctgaaggatatcctgcgaacgaagaaaaatttgagtggtca
aaaccgatgaagcttgttaagtgccaagaacaggcgacggcttccgatcagaagaaaaca
gagaaaaaaccggctgagccggcaaaagaaagcggggaagaacatgaaaaaaacactgaa
actgatcagtaa

DBGET integrated database retrieval system