KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2396Help
Entry
BAMF_2396         CDS       T01321                                 

Gene name
pstA
Definition
(GenBank) phosphate ABC transporter (permease)
  KO
K02038  phosphate transport system permease protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao02010  ABC transporters
Module
bao_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:bao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BAMF_2396 (pstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bao02000]
    BAMF_2396 (pstA)
Transporters [BR:bao02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    BAMF_2396 (pstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF5467
Motif
Other DBs
NCBI-ProteinID: CBI43522
Position
complement(2442689..2443573)
Genome map
AA seq 294 aa AA seqDB search
MNRKITDKLATGVFGLCAAVIAAILAGLFLYILIHGVSEITLHFLTSKSSAIASGGGIRD
QLFNSFYILFITMLITIPLGVGGGVFMAEYAPQNKVTDFIRTCIEVLSSLPSIVIGMFGM
LMFVNLTGWGYTIIGGALALTVFNLPVMVRVTEGALTAVPKELKEASLALGVSRWYTVKT
VLIPSAIPSILTGAILASGRVFGEAAALLFTAGLTTPRLNFTDLNPFSEASPLNIFRPAE
TLAVHIWSVNTQGIIPDAEAIANGGSAVLVISVLLFNLCARWLGSAIYKKLTAN
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaaataacggataaattggccaccggtgtattcggtttatgcgccgctgtg
atcgcggcgattttggcaggattgtttttgtatattctgattcacggcgtctctgaaatc
accttgcattttcttacgtcaaaatcgagcgccatcgcgtccggcggcgggatacgggat
cagctttttaactccttttacattctgtttatcaccatgctgatcacgataccgcttggt
gtggggggcggcgtctttatggctgaatatgcgccgcaaaataaagtcacagattttatc
agaacgtgtattgaagttctgtcgtcgcttccgtcgattgttatcgggatgttcggcatg
ctgatgtttgtgaacctgaccggatggggctacacgattatcgggggcgcgctcgcatta
acggtctttaatcttcccgtaatggtccgggtgacagaaggcgcgctcaccgcagttcct
aaggagctgaaagaagcttctctcgctttaggcgtatcgagatggtataccgtcaaaacc
gtgctgattccgagtgcgattccttcgattttaaccggcgccattttggcatcaggaaga
gtattcggagaagcggcggcattgttatttacagcggggctgacaacgccgcggctgaac
tttacggatttgaacccgttttcggaagcctctcctttaaacattttcaggccggctgaa
acgctggcggttcatatatggagtgtcaatacgcagggaatcattcccgatgcagaagcg
attgcaaacggcggctcggcagtgctggtgatctcggtgctcttgtttaacctttgtgca
agatggctcggatctgccatttataaaaagcttacggcaaattaa

DBGET integrated database retrieval system