KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2398Help
Entry
BAMF_2398         CDS       T01321                                 

Gene name
pstS
Definition
(GenBank) phosphate ABC transporter (binding lipoprotein)
  KO
K02040  phosphate transport system substrate-binding protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao02010  ABC transporters
bao02020  Two-component system
Module
bao_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:bao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BAMF_2398 (pstS)
  09132 Signal transduction
   02020 Two-component system
    BAMF_2398 (pstS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bao02000]
    BAMF_2398 (pstS)
Transporters [BR:bao02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    BAMF_2398 (pstS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 PBP_like SBP_bac_11 SBP_bac_1 SBP_bac_8 LysR_substrate SBP_bac_6
Motif
Other DBs
NCBI-ProteinID: CBI43524
Position
complement(2444551..2445453)
Genome map
AA seq 300 aa AA seqDB search
MKKNKWMLTLLMAAVMIVAAACGNAKESGKTDGQSASEDKKASGSLTISGSSAMQPLVLA
AAEKFMEKHPDADVQVQAGGSGTGLSQVSEGAVQIGNSDVFAEEKEGIDAKALKDHRVAV
VAMAAAVNPGAGVKDITKKQLADVFTGKIKNWKELGGKDQKITLVNRPDSSGTRATFVKY
ALDGAEPAEGITEDSSNTVKKIIAETPGAIGYLAFSYINDDKVTPLSIGGIKPEEKNVVT
GEYPIWAYEHSYTKGDASGLAKTFLDYLNSDDVQKSIVKDQGYIPISDMKVTRDANGKQS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaacaaatggatgcttacgcttctgatggctgctgttatgatcgttgctgca
gcatgcggaaatgcaaaggaaagcggcaagacggacggccaatctgcaagtgaggataaa
aaagcatcaggttctttaaccatttctggttcatcagccatgcagccgttagtactggca
gcggcggaaaagtttatggaaaaacatccggatgctgatgtgcaggtacaagcgggaggt
tcaggaacaggtctttcgcaagtgtctgaaggcgcagtgcaaatcggcaactcagatgtc
tttgccgaagaaaaagaaggcattgatgcgaaagccctaaaagatcaccgtgtagcggta
gtagcgatggcagctgcggttaacccgggtgcgggtgtgaaggatataaccaaaaaacag
ctggcagacgtctttacaggcaaaatcaaaaactggaaagagcttggcgggaaagatcaa
aagattactctcgtgaaccgtcctgattcatcaggaacacgcgctacattcgtcaaatac
gctcttgacggagcagagccggctgagggcatcacggaggattcctccaatacagtcaaa
aaaatcattgcggaaacaccgggagcaatcggttatctggcattctcttatataaacgat
gataaagtaacgcctttatcgatcggcggcatcaaaccggaagagaaaaatgtcgtcaca
ggcgaatatccgatttgggcttacgagcactcttatacgaaaggtgacgcgtcaggcctg
gcaaaaacatttcttgactatttgaacagtgatgatgttcagaaaagtatcgtaaaagat
cagggctacattccgatctctgatatgaaagtcacacgtgacgcaaacggcaagcaaagc
tga

DBGET integrated database retrieval system