KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2405Help
Entry
BAMF_2405         CDS       T01321                                 

Gene name
ispG
Definition
(GenBank) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase)
  KO
K03526  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00900  Terpenoid backbone biosynthesis
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01130  Biosynthesis of antibiotics
Module
bao_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAMF_2405 (ispG)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.1  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin)
     BAMF_2405 (ispG)
    1.17.7.3  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin)
     BAMF_2405 (ispG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GcpE HlyD zf-RING_7
Motif
Other DBs
NCBI-ProteinID: CBI43531
Position
2451966..2453093
Genome map
AA seq 375 aa AA seqDB search
MSEITHRTKTRPVTVGPLTIGGNNEVVIQSMTTTKTHDVEATVAEINRLAEAGCQIVRVA
CPDERAADAIADIKKRISIPLVVDIHFDYKLALKAIEGGADKIRINPGNIGRREKVEAVV
KAAKEKGIPIRIGVNAGSLEKRILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKA
SDVNLAIEAYEKASKAFDYPLHLGITESGTLFAGTVKSAAGLGAILSKGIGNTLRISLSA
DPVEEVKVARELLKSFGLASNAATLISCPTCGRIEIDLISIANEVEEYISKVKAPIKVAV
LGCAVNGPGEAREADIGIAGARGEGLLFRKGQIVRKVPEETMVEELKKEIDKLAEEHYAK
LEAEKAKAEQDTQKA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaatcacacatcgtacaaaaacgcgtcccgtcacagtgggacctttaacaata
ggcggaaataacgaagtcgtcattcagagtatgacgacgaccaaaacacacgacgtagaa
gcaacagtagcggaaatcaaccgattagccgaagccggctgccaaattgtccgggttgca
tgccctgacgaacgcgcagctgacgcgattgccgacatcaaaaaaagaatttcgatccct
ctcgttgtcgatattcattttgattacaagcttgccttaaaagcaatcgagggcggcgcc
gacaaaatcagaatcaacccgggaaacatcggccggcgcgaaaaagtggaagccgtcgta
aaagcggcgaaagaaaaaggaattccgatccggatcggcgtaaatgcaggatcattggaa
aaacgcattttggaaaagtacggctacccgactgctgacggaatggttgagagcgcgctt
catcacattaaaatcctggaagatcttgatttccacgacatcatcgtcagtatgaaagcg
tctgacgtcaatctcgccatagaagcatacgaaaaagcgtcaaaagcatttgattatccg
ctccacctcggaattacagaatcaggcacgctgtttgccggtacggtaaaaagcgcggcc
ggactcggagcgattttaagcaaaggaatcggaaacacgctccggatctctctgagcgct
gacccggttgaagaagtaaaagtagccagagagctgctgaaatcgttcggtctcgcttca
aacgcggctacgcttatttcatgcccgacatgcggacggatcgaaattgatctcatcagc
atcgcaaacgaagtggaagaatacatttcaaaagtaaaagcgccgattaaagtagccgtt
ctcggatgcgccgttaacggaccaggcgaagcgagagaagccgatatcggtattgccgga
gcgcgcggcgaaggactgcttttccgcaaaggccaaatcgtccgcaaagtccctgaagaa
acaatggtcgaagagctgaaaaaagaaatcgacaagctggcagaagaacactacgcaaag
cttgaggcggaaaaagccaaagcagaacaagacacacaaaaagcttga

DBGET integrated database retrieval system