KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2406Help
Entry
BAMF_2406         CDS       T01321                                 

Gene name
yqfX
Definition
(GenBank) conserved hypothetical protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4190 CrgA
Motif
Other DBs
NCBI-ProteinID: CBI43532
Position
complement(2453124..2453495)
Genome map
AA seq 123 aa AA seqDB search
MAYDYENRKGNDYYVDHGSEGTDITRDVYSEETAAEIAEPYRASDRTADRDDNRDGVSEG
RGIGYAALAISIISLFVLPVLLGACGIIVGYIARRRGAGALGGWAMGIGIVSLVLGIFIT
PFF
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
gtggcatacgattacgaaaatcgaaaaggcaacgactactatgtggatcatggatcggaa
ggaacggatatcacgcgtgatgtttattcagaagaaacagcggctgaaattgcagagcca
tatcgcgcttctgaccggacagcagaccgcgatgataaccgggacggagtaagtgaaggc
cgggggatagggtatgcagcattggctatttctatcatttccctgtttgtgctccctgtt
ttattaggagcatgcggcattatcgtcggctatatcgccagaagaagaggagcaggcgct
ttaggcggatgggcgatgggaatcggtatagtttcccttgtgctgggcatattcattaca
ccgtttttctaa

DBGET integrated database retrieval system