KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2407Help
Entry
BAMF_2407         CDS       T01321                                 

Gene name
yqfW
Definition
(GenBank) putative nucleotidase
  KO
K05967  uncharacterized protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BAMF_2407 (yqfW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-nucleotidase Acid_phosphat_B Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: CBI43533
Position
2453635..2454216
Genome map
AA seq 193 aa AA seqDB search
MLRLGIDIDGTVTAQDTFVPYLNRSFHLSITLDDMTDYDLTKLLNITTEEFWEWMNVHEA
VIYKEAKLAEFAKQALDGLKEEHRLIYITARRGHLEDVTLDWFANRDIHYDHIELVGGHH
KVEAVKKHGIDLFFEDHHGNATMIAKEAGIPVILFDSPYNQLPIDSNIIRVRNWLEAVAW
INKNKHSLQHVKS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgttacggttaggtatagatattgacggcacggttacggcacaggatacatttgtccct
tatttaaaccgctcatttcatctttctattactttggatgatatgactgattatgatctg
actaagcttttgaacattacaaccgaggaattttgggaatggatgaatgttcatgaagca
gtcatatataaagaagcaaagctcgcggaatttgccaagcaagcgctggacgggctgaaa
gaagaacatcgtctcatttacataacggcaagacgcggccacttagaagatgtaacgctg
gactggtttgcaaaccgggacattcattatgatcacattgagcttgtcggaggccatcac
aaagtggaggccgtcaaaaaacacggcatcgatctgttttttgaagatcaccacggcaac
gcgacaatgatcgcaaaagaagcgggcattccggttatcctttttgattccccttacaat
cagctccccatcgattccaatattatcagggtgcggaattggcttgaagccgtcgcctgg
atcaataaaaacaaacacagccttcagcatgtcaaaagctga

DBGET integrated database retrieval system