KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2432Help
Entry
BAMF_2432         CDS       T01321                                 

Gene name
yqfD
Definition
(GenBank) stage IV sporulation protein
  KO
K06438  similar to stage IV sporulation protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BAMF_2432 (yqfD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YqfD
Motif
Other DBs
NCBI-ProteinID: CBI43558
Position
complement(2478147..2479337)
Genome map
AA seq 396 aa AA seqDB search
MKNKWLSFFSGKVQMEVKGKGIERLLNECTRNGIAIFAVKKKQDCVMLMIQLQDVHAFRR
VIRNHECKASFTKRKGLPFLLLKSKLNIGFTAGFVIFFIILFLLSNMIWEIDIKGAKPET
EHQMVKHLEEIGVKKGRLQFLMMTPEKIQKSLTNGIENITWVGVELNGTALHMKVVEKNE
PTKEKYLSPRHIVAKKKAVIKRMFVQKGQPMAFVNDHVDKGQLLVSGLIGNEEQQKKVTS
KAEIYGETWYKSEVTVPLETSFTLYTGKVRTKHKLSFGSWGVPFWGFGFNEEPLKHPKTE
EEKHPFQFLGLKLPVSYVQEHIRESETSVRTYKKDEAVQAGIKMGRQDVEKRLSGSGEVE
SEKVLHQSVENGKVKLIILYQVIEDIVQTTPIVQGD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacaaatggctgtcatttttttcgggtaaagtccaaatggaagtcaaaggaaaa
ggaattgaacggctgcttaatgaatgtacaagaaacggaattgctatctttgcggtgaaa
aaaaagcaagactgtgtaatgcttatgattcagcttcaggatgtacatgctttcagaaga
gtcatcagaaaccatgaatgcaaagcaagctttacaaaaagaaagggcctgccctttctg
cttctcaaatctaaattaaacataggctttaccgcggggtttgtgatttttttcattata
ttgttccttttgtccaacatgatttgggaaatcgatattaaaggggccaagcccgaaact
gagcatcagatggtaaagcaccttgaagaaatcggtgtgaaaaaaggccgtttgcaattt
ttaatgatgacgccggagaaaattcaaaaatcattaacaaacggcatcgaaaatattacg
tgggtcggtgtggaattgaacgggacagcccttcatatgaaagtggtcgaaaaaaatgaa
ccgacaaaagaaaaatacttgagcccccgccatattgttgccaaaaagaaagcggtcatc
aaaagaatgttcgtgcaaaagggtcagccgatggcttttgtgaacgatcatgttgacaaa
ggccagctccttgtctcaggtctgatcggtaatgaagagcagcagaagaaagtcacctca
aaagcggaaatttacggagaaacatggtacaagtctgaagtaaccgtgcctcttgaaaca
tcatttacgctatatacgggtaaagtaaggacgaagcacaagctgtctttcggatcatgg
ggcgtgcctttttggggcttcgggtttaatgaagagccgctgaaacatccgaaaaccgag
gaagaaaagcacccgtttcaatttctggggttaaagctccctgtttcttacgtccaagaa
catataagagaaagcgaaacatccgtgcggacttataaaaaagacgaagcggttcaggcc
ggcatcaaaatgggcaggcaagacgtagaaaagcgattaagcggcagcggagaggtggaa
agtgaaaaagttttgcaccaatccgttgagaatggtaaagtaaagttgattattctctac
caagttatagaagatatcgttcaaaccacacctattgttcagggagactaa

DBGET integrated database retrieval system