KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2437Help
Entry
BAMF_2437         CDS       T01321                                 

Gene name
yqeY
Definition
(GenBank) conserved hypothetical protein
  KO
K09117  uncharacterized protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BAMF_2437 (yqeY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YqeY GatB_Yqey Ribosomal_S8e DUF3349
Motif
Other DBs
NCBI-ProteinID: CBI43563
Position
complement(2482610..2483056)
Genome map
AA seq 148 aa AA seqDB search
MSLLERLNQDMKLYMKSREKDKLTVVRMVKASLQNEAIKLKKDSLTEDEELTVLSRELKQ
RKDSLHEFSNANRLDLVDKVQKELDILEVYLPKQLSEEELQTIVNETIAEVGASSKADMG
KVMSAIMPKVKGKADGSVINRLVSSQLS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttcttgagcgacttaaccaagatatgaagctgtatatgaaaagccgtgagaaa
gacaaactgactgtcgttcgaatggtgaaagcttcacttcaaaacgaagcaattaagctt
aagaaagacagtttgaccgaggatgaggaacttactgtcctatctcgtgaacttaagcaa
cgtaaagactccctccatgaattttcaaacgctaatcgtttagatttagtagataaagtt
caaaaagagctggacattttagaagtttatttaccgaagcagctttctgaagaagagctg
cagacaatcgtaaatgaaaccatcgctgaagtcggtgcgagctctaaagcggacatgggc
aaagtgatgagtgctattatgcctaaagtaaaaggtaaagctgacggcagtgtgattaac
agacttgtcagcagtcaattatcctaa

DBGET integrated database retrieval system