KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2438Help
Entry
BAMF_2438         CDS       T01321                                 

Gene name
rpsU
Definition
(GenBank) ribosomal protein S21
  KO
K02970  small subunit ribosomal protein S21
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao03010  Ribosome
Module
bao_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bao00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BAMF_2438 (rpsU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bao03011]
    BAMF_2438 (rpsU)
Ribosome [BR:bao03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    BAMF_2438 (rpsU)
  Bacteria
    BAMF_2438 (rpsU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S21 CBS
Motif
Other DBs
NCBI-ProteinID: CBI43564
Position
complement(2483071..2483244)
Genome map
AA seq 57 aa AA seqDB search
MSKTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKRKKKSEAARKRKF
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaacggtcgttagaaaaaacgaatcgcttgaagatgctcttcgtcgcttcaaa
cgcagtgtatcaaagacaggtactttgcaagaagcaagaaagcgcgaattttatgaaaaa
cctagcgtaaagcgcaagaaaaagtcagaagctgctagaaaacgcaaattctaa

DBGET integrated database retrieval system