KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2444Help
Entry
BAMF_2444         CDS       T01321                                 

Gene name
dnaK
Definition
(GenBank) molecular chaperone
  KO
K04043  molecular chaperone DnaK
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bao00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BAMF_2444 (dnaK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bao03019]
    BAMF_2444 (dnaK)
   03110 Chaperones and folding catalysts [BR:bao03110]
    BAMF_2444 (dnaK)
   03029 Mitochondrial biogenesis [BR:bao03029]
    BAMF_2444 (dnaK)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bao04147]
    BAMF_2444 (dnaK)
Messenger RNA biogenesis [BR:bao03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     BAMF_2444 (dnaK)
Chaperones and folding catalysts [BR:bao03110]
 Heat shock proteins
  HSP70 / DNAK
   BAMF_2444 (dnaK)
Mitochondrial biogenesis [BR:bao03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    BAMF_2444 (dnaK)
  Matrix
   MMC/PAM proteins
    BAMF_2444 (dnaK)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    BAMF_2444 (dnaK)
Exosome [BR:bao04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BAMF_2444 (dnaK)
  Exosomal proteins of breast cancer cells
   BAMF_2444 (dnaK)
  Exosomal proteins of colorectal cancer cells
   BAMF_2444 (dnaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C AAA_23
Motif
Other DBs
NCBI-ProteinID: CBI43570
Position
complement(2488794..2490632)
Genome map
AA seq 612 aa AA seqDB search
MSKVIGIDLGTTNSCVAVLEGGEPTVIANAEGNRTTPSVVAFKNGERQVGEVAKRQSITN
PNTIMSVKRHMGTDYKVEIEGKDYTPQEVSAIILQHLKAYAESYLGETVSKAVITVPAYF
NDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKTDEDQTILVYDLGGGTFDVSVLE
LGDGVFEVRSTAGDNRLGGDDFDQVIIDHLVAEFKKENGIDLSKDKMALQRLKDAAEKAK
KDLSGVSSTQISLPFITAGEAGPLHLELTLTRAKFEELSAHLVERTMAPVRQALQDADLS
ASEIDKVILVGGSTRIPAVQEAIKKETGKEAHKGVNPDEVVALGAAIQGGVITGDVKDVV
LLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTAADNQTAVDIHVLQGERPMSAD
NKTLGRFQLTDIPPAPRGVPQIEVSFDIDKNGIVNVRAKDLGTGKEQNITIKSSSGLSDD
EIERMVKEAEENADADAKRKEEIEVRNEADQLVFQTEKTLKDLEGKVDEEQVKKANDAKD
ALKAAIEKNEIEEIKAKKDEIQTIVQELSMKLYEEAAKAQQAEGGANAEGKKADDNVVDA
EYEEVKDDEAKK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaagtaatcggaattgacttgggtacgacaaactcatgtgtggcagtgcttgaa
ggcggcgagcctacagttatcgccaatgctgaaggaaaccgtactactccgtcagtcgtt
gcatttaaaaacggcgagcgccaagtaggggaagtggcaaaacgccaatcaatcacaaac
cctaacacaatcatgtctgtcaaacgccatatgggtactgactataaagtagaaatcgaa
ggaaaagactacacgcctcaagaagtgtcagctattatccttcagcatctgaaagcatac
gctgaaagctacctgggcgaaacagtttcaaaagctgttatcacggttccggcatacttc
aacgatgcagagcgtcaagcgacaaaagatgccggtaaaatcgccggtcttgaagtagag
cgtattatcaacgaaccgactgcagcagcgcttgcatacggacttgataaaacggacgaa
gaccaaaccattcttgtatacgaccttggcggcggtacgtttgacgtatctgttcttgaa
cttggcgacggcgtgtttgaagtccgttcaactgccggtgacaaccgtcttggcggggac
gactttgaccaagtcatcattgatcatctcgtagcagaattcaaaaaagaaaacggcatt
gatctttcaaaagacaaaatggcgcttcagcgtttgaaagatgcagctgagaaagcgaaa
aaagacctttccggcgtatcatctacgcaaatttctttaccatttatcacagcgggagaa
gcaggtcctcttcaccttgagctgacattgacccgcgctaaatttgaagagctttccgct
catcttgttgaacgcacaatggctcctgtccgtcaggctcttcaagatgcggatctttct
gcaagcgaaatcgacaaagttattcttgtcggcggatctacacgtattcctgccgtacag
gaagcaatcaaaaaagaaacaggtaaagaagcgcataaaggcgtaaaccctgatgaagtt
gtagcgcttggtgctgcgattcaaggcggcgtcatcacaggagacgtaaaagacgttgta
cttcttgacgttacaccgctttctctcggtattgaaacaatgggcggcgtgttcacgaaa
ctgatcgaccgcaatacgacaattccgacgagcaagtctcaagtattctcaactgcagct
gacaaccaaacagctgttgacattcacgtgcttcaaggtgagcgcccgatgtctgccgac
aacaaaacgctcggccgcttccagcttactgatatcccgcctgcaccgcgcggcgtaccg
caaatcgaagtttctttcgatattgacaaaaacggtatcgtaaacgtaagagcgaaagac
ttaggcacaggaaaagaacaaaacattacaatcaaatcttcttcaggtctttcagatgac
gaaatcgaacgcatggtaaaagaagcggaagaaaacgctgacgctgatgcgaagagaaaa
gaagaaatcgaagtccgcaacgaagctgaccagcttgtgttccaaacggaaaaaactcta
aaagacctggaaggcaaagtggacgaagagcaagtgaaaaaagcaaacgacgcgaaagac
gcgctgaaagcagctatcgagaaaaacgaaattgaagagatcaaagcgaaaaaagatgag
attcaaacaatcgttcaagagctttccatgaagctttatgaagaagcggcaaaagcgcag
caggctgaaggcggagcaaacgctgaaggcaaaaaagcggacgataacgttgtcgatgcg
gaatacgaagaagtaaaagacgacgaagcgaaaaaataa

DBGET integrated database retrieval system