KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2449Help
Entry
BAMF_2449         CDS       T01321                                 

Gene name
yqxA
Definition
(GenBank) conserved hypothetical protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3679
Motif
Other DBs
NCBI-ProteinID: CBI43575
Position
complement(2495562..2495900)
Genome map
AA seq 112 aa AA seqDB search
MIRFTGKCLLIAIVMFFGVLFGMQQANSGMLDMKGYKDPSLKGAFTLGGGEGQEKEASIL
GQTVTAKDLEEKQKQLEQAETFNLFSKAGETLSNTVTDSAQAMYEWVSKLNR
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgatccgttttaccggcaaatgcctgctgatcgccattgtcatgtttttcggcgttttg
ttcggcatgcagcaggcaaacagcggaatgcttgatatgaaaggatacaaagatccctcc
ttaaaaggagcattcacgctcggcggcggagaaggacaggaaaaagaagcttccattttg
gggcaaaccgttacggcgaaagatctggaagaaaaacaaaaacagctggaacaggcggaa
accttcaacctgttttcaaaagcgggagaaaccctttcaaataccgtgacggactcggcg
caggcgatgtacgagtgggtttcgaaactgaaccgatag

DBGET integrated database retrieval system