KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2450Help
Entry
BAMF_2450         CDS       T01321                                 

Gene name
spoIIP
Definition
(GenBank) spore autolysin (stage II sporulation)
  KO
K06385  stage II sporulation protein P
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BAMF_2450 (spoIIP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIP Amidase_3
Motif
Other DBs
NCBI-ProteinID: CBI43576
Position
complement(2495917..2497110)
Genome map
AA seq 397 aa AA seqDB search
MRKKRRNRQIVVAVNGGNALKGMFLFMTSLIVIFVLSGVLTSLRPELRLSSDSLHGIAGE
LPGDAFAHLLGMENHYFASELPEKDSFQLSRLSLKLATSINMEDPRSFLGRELPGFAQYD
TEILLAGQGTDYTNMPAESPPPSKVMEKEKEVNLAEIENKTKKEETAPPKHSTGSKKVVF
IYHTHNTESYLPLLKGETNPDNARHSKANVTLVGDMFGKALEAQGVGATVDKTDIQARLN
KDGLNYARSYDESRPVVKSALAKNKNLQYTIDIHRDSRRKKNTTADIKGKSYARVAIVVG
KKSANFEENYKLASELHKLMEKKYPGLSVGVLSKGSPGDNGVYNQDLNDRSLLLEFGGVD
NNLEELRRASDAVADVFSELYWDADKVSSQSGEKKKQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaacgcagaaaccgtcaaattgtcgttgcagtaaacggtggaaatgcgctc
aagggcatgtttttgtttatgacaagccttatcgttattttcgtattatcgggtgtgctc
acatcgcttcgccctgaactgaggctttcttcggattctcttcacggaattgccggagaa
cttccgggtgacgcgtttgcacacctcctcggtatggaaaatcattatttcgcctcagag
cttcctgaaaaagactcttttcagttgtcccggctttccttaaaactggcgacaagtatt
aatatggaagacccgcggagtttcttgggacgtgagctgccgggatttgcccaatacgat
acggagatccttctggcggggcaggggacggattatacgaatatgcctgctgaatctccg
ccgccgtcgaaggtgatggaaaaagaaaaagaagtgaacctggcagaaatcgaaaacaaa
acgaaaaaagaagaaacggcgccgccgaaacattcaacaggcagcaaaaaagtcgttttt
atttaccacactcataataccgaatcttatcttcctctgttaaagggggaaacaaatcct
gataacgcccgccattcgaaggccaatgtcacgcttgtcggagatatgttcggaaaagcg
cttgaagcgcaaggtgtaggagcgaccgtagataaaaccgacattcaggcccgcctgaac
aaagacggcttaaattatgcgcgaagctatgacgaatcaaggccggtcgtaaaaagcgcg
ctcgccaaaaataaaaatctgcaatataccatagacattcaccgggattcccgccgcaag
aaaaatacgacagccgacatcaaaggaaaaagctatgccagagtcgccatcgtggtcggc
aaaaaaagcgctaattttgaagaaaactataaactcgcaagtgaacttcataagctgatg
gagaaaaaataccccggcttaagcgtcggtgttttatcaaaaggctctccgggagataat
ggagtatacaaccaggatttaaacgacaggtcgcttctgctggaattcgggggcgtggat
aacaatcttgaagaactgaggcgcgcatcagatgccgtggccgatgtgttcagcgaactg
tactgggatgcagacaaggtcagctcgcaatcaggagagaagaaaaaacaatag

DBGET integrated database retrieval system