KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2451Help
Entry
BAMF_2451         CDS       T01321                                 

Gene name
gpr
Definition
(GenBank) spore endopeptidase
  KO
K06012  spore protease [EC:3.4.24.78]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bao01002]
    BAMF_2451 (gpr)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.78  gpr endopeptidase
     BAMF_2451 (gpr)
Peptidases [BR:bao01002]
 Aspartic Peptidases
  Family A25: gpr protease family
   BAMF_2451 (gpr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A25 DUF1256
Motif
Other DBs
NCBI-ProteinID: CBI43577
Position
complement(2497178..2498284)
Genome map
AA seq 368 aa AA seqDB search
MKNNELDVNQFLIRTDLAVETKQAVKDGQAGQTKEINGFIEKERDKGGIKVRTVDITKEG
AELSGKKQGRYVTIEAQGVREHDSDMQEKVTEVFAEEFSAYLSALKIPKDASCLIVGLGN
WNVTPDALGPLVTENLLVTRHLFRLQPENVQEGYRPVSALAPGVMGLTGIETSDIIQGVI
KESKPDFVIAVDALAARAVERVNTTIQFSDTGIHPGSGVGNKRKELSKETLGIPVIAIGV
PTVVDAVTIASDTVDYILKHFGREMKDDSPSRSLVPAGMNFGKKKVLTDEDLPGEKERQS
FLGIVGTLDENEKRQLIHEVLSPLGHNLMVTPKEIDTFIDDMANVLANGLNTALHEKVSQ
DNKGSYNH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacaacgaactggatgtcaatcaatttctgatacggacggatttagcggtagaa
acgaaacaggcggtaaaagacggacaagccggtcagacaaaagaaataaacgggtttatt
gaaaaagaacgcgacaagggcggcattaaagtcagaaccgtcgatattaccaaagaaggc
gccgagctatcggggaaaaagcagggacgctatgtcacgatcgaggctcaaggggttcgg
gaacacgactctgacatgcaggaaaaagtaacggaagtgtttgccgaggaattttccgcc
tatctgtcggcattaaagattccaaaggatgcaagctgtttgatcgtcggtctcggcaac
tggaatgtgacgccggatgcgctcggccctctcgtgaccgaaaaccttcttgtgacaagg
catctgttcaggcttcagccggaaaacgtacaggaagggtacaggccggtcagcgcgctt
gctcccggtgtgatgggattaacgggaattgaaacgagcgatattattcaaggtgtgatc
aaagaatcaaagccggattttgtgattgcggtagacgctcttgcggcaagagccgttgaa
agggtgaacacgaccatccaattttctgatacgggcattcacccgggatcaggcgtcggc
aataagagaaaagaattaagcaaggaaacgctcggcatccccgtcatcgcaatcggggta
ccgactgtcgttgatgcggttacgatcgcgagcgatacggtggattatatattaaagcat
ttcggcagagagatgaaagatgacagcccgtcaagatctctggtgcccgccggaatgaac
ttcggcaaaaagaaggtgctgacagacgaagatcttcccggagaaaaagaacgccaatcc
tttctcggtattgtcggcacgctggacgaaaacgaaaaacgccagctgattcacgaagtg
ctctctccgctcggccataatctgatggtcacgccgaaggagattgacacctttattgat
gatatggcgaacgtgcttgcaaacgggttaaacaccgcccttcatgaaaaagtgtcacaa
gataacaaaggttcttataatcattaa

DBGET integrated database retrieval system