KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2452Help
Entry
BAMF_2452         CDS       T01321                                 

Gene name
rpsT
Definition
(GenBank) ribosomal protein S20 (BS20)
  KO
K02968  small subunit ribosomal protein S20
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao03010  Ribosome
Module
bao_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bao00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BAMF_2452 (rpsT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bao03011]
    BAMF_2452 (rpsT)
Ribosome [BR:bao03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    BAMF_2452 (rpsT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S20p SseC DUF3355 DUF1542
Motif
Other DBs
NCBI-ProteinID: CBI43578
Position
2498487..2498753
Genome map
AA seq 88 aa AA seqDB search
MPNIKSAIKRTKTNNERRAHNATIKSAMRTAIKQVEASVANNEADKAKTALSEAAKRIDK
AVKTGLVHKNAAARYKSRLAKQVNGLSA
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacattaaatcagcgattaaacgtacaaaaacaaacaacgaacgccgcgctcat
aacgcgacaatcaaatctgctatgcgtactgcaatcaaacaagttgaagcttctgttgct
aacaacgaagcggataaagcgaaaactgctctttctgaagcagcgaaacgcattgataaa
gcagtgaaaacaggtcttgtacacaaaaatgccgcagctcgatacaaatctagacttgcg
aaacaagtgaacggactttctgcataa

DBGET integrated database retrieval system