KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2454Help
Entry
BAMF_2454         CDS       T01321                                 

Gene name
yqzM
Definition
(GenBank) conserved hypothetical protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YqzM
Motif
Other DBs
NCBI-ProteinID: CBI43580
Position
2500040..2500180
Genome map
AA seq 46 aa AA seqDB search
MKLNDFEKNVQSKRNDAVDSAVGFVVSFGFFAFLFVMATAIHLIGS
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaatgattttgaaaaaaacgttcaaagcaaacgaaatgatgctgttgactca
gctgtcggttttgtcgtgtccttcggatttttcgcctttttgttcgtgatggcaacagcc
atccatcttatcggctcttag

DBGET integrated database retrieval system