KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2456Help
Entry
BAMF_2456         CDS       T01321                                 

Gene name
comEB
Definition
(GenBank) putative enzyme associated to DNA transport (competence)
  KO
K01493  dCMP deaminase [EC:3.5.4.12]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00240  Pyrimidine metabolism
bao01100  Metabolic pathways
Module
bao_M00429  Competence-related DNA transformation transporter
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BAMF_2456 (comEB)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.12  dCMP deaminase
     BAMF_2456 (comEB)
Secretion system [BR:bao02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   BAMF_2456 (comEB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam IMS XOO_2897-deam
Motif
Other DBs
NCBI-ProteinID: CBI43582
Position
complement(2502551..2503120)
Genome map
AA seq 189 aa AA seqDB search
MERISWNQYFMAQSHLLALRSTCPRLSVGATVVRDKRMIAGGYNGSIAGGVHCADEGCLL
IDNHCQRTIHAEMNAILQCSKFGVPTEGAEIYVTHYPCIQCCKSIIQAGIKTVYYAEDYK
TQPYAKELFSQAGVKVEQVELDEMIIDLKNREKLSFVAGLIQQLSDAGVKADELKKIHEQ
ANELFTSYV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgaatctcatggaatcaatattttatggcgcaaagccatttgctggcgctgaga
agcacatgtccgagactgtcagtcggggcaaccgtagtcagagataagcggatgattgcc
ggcggatacaacggctcaattgccggcggcgtccattgcgctgatgaaggatgcctttta
atagataatcattgccagaggaccatacatgcagagatgaatgcgattctgcaatgttct
aagttcggtgttccgacggagggcgccgaaatttatgtgacgcattatccttgtattcaa
tgctgcaaatcaattatccaggcaggcatcaaaacggtctattatgccgaagattacaaa
acacagccttatgcaaaagagctgttcagccaagccggagtcaaggtggagcaggtcgaa
cttgatgaaatgatcatcgatctgaaaaaccgcgaaaaattgtcttttgtagcaggtctg
attcagcaattatctgatgcgggagttaaggcagatgaactgaaaaaaattcatgaacag
gccaatgagctgtttaccagttacgtataa

DBGET integrated database retrieval system