KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2460Help
Entry
BAMF_2460         CDS       T01321                                 

Gene name
yqeL
Definition
(GenBank) conserved hypothetical protein
  KO
K09710  ribosome-associated protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bao03009]
    BAMF_2460 (yqeL)
Ribosome biogenesis [BR:bao03009]
 Prokaryotic Type
  Other maturation factors
   BAMF_2460 (yqeL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsfS
Motif
Other DBs
NCBI-ProteinID: CBI43586
Position
complement(2505484..2505840)
Genome map
AA seq 118 aa AA seqDB search
MNQASVLKIAAKACDDKRAEDILALDMEGISLVADYFLICHGNSDKQVQAIAREIKDQAE
ENGIDVKKMEGFDEARWVLVDLGDVIVHVFHKDERSYYNLEKLWGDAPLAELELGLNS
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcttccgtattaaaaatcgcggcaaaagcatgcgacgataaacgtgcagaa
gatattttagcgctggacatggaaggaatctcacttgtagcggattactttttaatctgc
cacgggaattctgataaacaggttcaggccattgcgcgtgaaattaaagatcaggcagaa
gaaaacggcattgatgtcaaaaagatggaagggtttgatgaggctcgctgggttttagtt
gatctcggcgacgtcattgtccacgttttccataaagatgaaagaagctactataatctt
gaaaagctatggggcgacgcgccgctcgcagagcttgaactcggcttgaactcatga

DBGET integrated database retrieval system