KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2462Help
Entry
BAMF_2462         CDS       T01321                                 

Gene name
nadD
Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K00969  nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00760  Nicotinate and nicotinamide metabolism
bao01100  Metabolic pathways
Module
bao_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BAMF_2462 (nadD)
Enzymes [BR:bao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     BAMF_2462 (nadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: CBI43588
Position
complement(2506408..2506977)
Genome map
AA seq 189 aa AA seqDB search
MKKIGIFGGTFDPPHNGHLLMANEVLHQAELDEIWFMPNKIPPHKQNEDFTDSRHRVEML
KLAISSNSFFKLELAEMDRKGPSYTYDTVRLLKERHPNDKLFFIIGADMIEYLPKWYKLD
ELLTLIQFIGVRRPGYHIETPYPLLFADVPEFDVSSTMLRERLKAKKPTQYLMPNKVRQY
IEENDLYES
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcggaatattcgggggcacatttgaccctccgcacaacggacatcttctg
atggctaatgaagtccttcatcaggcggagctcgatgagatttggtttatgcccaataaa
atcccgccgcataagcagaatgaagactttacagacagccggcaccgggtggagatgctg
aagcttgccatcagctctaattccttctttaagcttgagcttgcggaaatggaccggaaa
ggcccttcttatacctatgataccgtccgtttactgaaggagcggcacccgaacgacaag
cttttctttattatcggggcggatatgattgaatatctgccgaaatggtacaaactggac
gaactgctcacgctcattcaatttatcggagtgcggcgcccggggtatcatattgagaca
ccgtacccgctgctttttgccgacgttccggaatttgacgtttcgtcaacgatgctgaga
gaacgtctcaaagcaaaaaagccgacgcaatacttaatgccgaataaagtgaggcagtat
atagaggagaatgatttatatgaatcgtga

DBGET integrated database retrieval system