KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2464Help
Entry
BAMF_2464         CDS       T01321                                 

Gene name
aroD
Definition
(GenBank) shikimate 5-dehydrogenase
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bao01100  Metabolic pathways
bao01110  Biosynthesis of secondary metabolites
bao01130  Biosynthesis of antibiotics
bao01230  Biosynthesis of amino acids
Module
bao_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAMF_2464 (aroD)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     BAMF_2464 (aroD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N Shikimate_DH Sacchrp_dh_NADP F420_oxidored NAS IFT43
Motif
Other DBs
NCBI-ProteinID: CBI43590
Position
complement(2507272..2508114)
Genome map
AA seq 280 aa AA seqDB search
MKQLYGVIGNPIGHSMSPDIHNAALQDKNINGQYFAFQVEPRHLKDAVNGIKALGICGVN
VTVPHKVAIMEHLDEIHESAKVLGAVNTVKREGDRLIGYNTDGDGFYKSLVKVLDKPISE
LSILMIGAGGAARAIFTTIVRREPKQFDVCNRTPEKAESLIAAAPSFQQKRALTLKEAEN
QLEQYDVIIHTTSVGMYPKTDAVPLSLERAKTGAIVCDIVYNPIQTAFLKEAEKRGLTTL
DGVGMFVEQAALSFKLWTEQEPDSSLMRAIVEGKLGGTQC
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattgtacggagtaatcggaaatccgatcgggcattcaatgtcacccgatatt
cataacgcagctttgcaagataagaacatcaacgggcagtattttgcgtttcaggtggaa
cctcgtcatctcaaggacgccgttaacggaatcaaggcgcttggcatctgcggagtgaac
gtcacagtcccgcataaagtcgcgatcatggagcatctggatgaaatacatgaaagcgcg
aaagtactcggggccgtaaataccgtcaaaagagagggagacaggctcatcgggtataat
actgacggagatgggttttataaatccttagtcaaagtattggacaaaccgatatcagag
ctctccatcctcatgattggggcgggaggagcggcaagagcgatttttacgacgatcgtc
cgcagagagccgaaacaatttgacgtttgcaaccgcacgccggaaaaagcagaaagtctg
attgctgctgctccctcttttcagcagaaacgcgcccttactttaaaagaagctgaaaat
cagcttgaacaatatgacgtcattattcatacaacatctgtcggcatgtatccgaaaacg
gatgccgtgccgctctcattggaacgggccaaaacgggcgccatcgtttgtgatatcgta
tacaacccgattcaaacggcgttcttaaaagaagctgaaaaaagaggtttaacaaccctt
gacggtgtcggcatgtttgtggaacaggctgcactgtctttcaagctgtggacggaacaa
gagcctgacagcagcttaatgagagcaattgttgaaggaaaactaggaggaacacaatgt
taa

DBGET integrated database retrieval system