KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2469Help
Entry
BAMF_2469         CDS       T01321                                 

Gene name
RBAM_024010
Definition
(GenBank) RBAM_024010
  KO
K22278  peptidoglycan-N-acetylglucosamine deacetylase [EC:3.5.1.104]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
Enzymes [BR:bao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.104  peptidoglycan-N-acetylglucosamine deacetylase
     BAMF_2469 (RBAM_024010)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1 Polysacc_deac_2
Motif
Other DBs
NCBI-ProteinID: CBI43595
Position
complement(2511395..2512129)
Genome map
AA seq 244 aa AA seqDB search
MRCFHLIIMICVLTSLTAVSADAKSLKRSDMEKTGNVYWDIRSEKKKLSLTFDDGPHPVY
TEAVLDVLKQHNVKATFFCIGSRIDKYPITAKRIVEEGHEIGNHTMNHVYFHRLKRKDIL
QELHSSAHHIRSLQPEGDKLFRPPGGSLNQTAFKSILKEGYHIIMWSWNQDPRDWKRPGK
GKIVRHVVSHARDGDIVLLHDGGGNRRQTVEALKEIIPQLKKQGYTFVKVSDLIGQDSGP
FHIQ
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttgagatgctttcatctgatcatcatgatatgcgtcctcacgagtctcactgccgtgtcc
gccgatgcgaaatctttaaaaagaagtgacatggagaagacgggaaacgtgtactgggat
ataaggtctgaaaaaaagaagctatctttaaccttcgatgacggcccccatcctgtctat
acggaggctgtgttagacgtgctgaaacagcacaatgttaaagcaacctttttttgtatc
gggagccgtatagacaaataccccataacggcaaaacgcatcgttgaagaaggacatgaa
atcggcaaccatacgatgaaccatgtttattttcaccgtttaaaacgcaaagacatttta
caagagcttcacagctccgcgcatcatatcagatcgctgcagccggaaggggacaagtta
ttccgcccgccgggagggtcgttgaatcagacggctttcaaaagcatcttaaaagagggc
tatcatatcatcatgtggtcatggaaccaagatccgagggactggaaaaggcccggaaaa
ggaaaaatcgtcaggcacgttgtttcacatgccagagatggagatatcgttcttctgcat
gacggcggaggaaaccggcgccagacggtggaggctttgaaagaaatcattccccagctg
aaaaagcagggctacacgtttgttaaggtttcggatttgatcggacaggattccggtcct
tttcatatccagtaa

DBGET integrated database retrieval system