KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2471Help
Entry
BAMF_2471         CDS       T01321                                 

Gene name
RBAM_024030
Definition
(GenBank) RBAM_024030
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 DUF1748 Cornichon
Motif
Other DBs
NCBI-ProteinID: CBI43597
Position
complement(2513441..2514697)
Genome map
AA seq 418 aa AA seqDB search
MKNLKSWRYPMLLLTGIGIANIGEWIYFLSLNLIVLKETGSAFAVSILYLIRPAAVLMTN
GWSGSIIDRCNKRNMMMSLDFIRAAFIAVLPLMFTVWSLFSIYCIVFLIQMANAMFRPCS
MAYVTMLIPAERRKRFNSLRALSESGAFLLGPAAAGLLFIAGTPIFAIWVNAAALVLSGF
ITMMLPSLENEPHVHSPAQKLSLAVYKEDWKLVYRFSRTARNVMIIYFLFSLVMTVMPSA
LDSLEAAFAKEVLQLTDADYGFLVSVSGAGVIAGALVNVFFNKKMPASLLMGMGSLFTAA
GYMIYAFSDVFWTAAFGFFLLAFFLAFANTGFQTFYQKNVPVDIMGRVGSFYSLVEAVFI
IVVTAVFGAAAVSSSVRGIVIAGAAVMLALAAILCSFLFAASKRRTPDVFQADQFKQT
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctgaagtcttggcggtacccgatgcttctgttaaccggaatcgggatagca
aatattggtgaatggatttattttttgtctcttaatcttattgtcttaaaagaaacgggg
tctgcttttgcggtttccatcctttatttaatcaggcctgcggctgtattgatgacaaat
gggtggtcgggcagcatcatcgaccggtgtaacaaacggaatatgatgatgtcgcttgat
ttcatccgggctgcattcattgccgttctgccgttgatgtttactgtatggtctttattt
tccatttattgtatcgtgtttttgattcaaatggccaatgcgatgtttcgtccgtgttcc
atggcgtatgtgacgatgcttattccggctgaaaggagaaaacgattcaattcactaagg
gctttgtcggaatcaggggcttttctcctcgggccggctgcggccgggctgctttttatc
gccggcacgccgatttttgcgatttgggtgaatgcggcggctttggtgctgtccggtttc
atcacgatgatgctgccgagccttgaaaatgagccccacgtacattctcccgcacagaag
ctttctttggcagtgtacaaagaagattggaagctcgtctatcgcttcagccgaacggcg
cgaaacgtcatgatcatttattttttattcagtctggtcatgaccgttatgccatccgcg
cttgattcgcttgaagccgcttttgcaaaagaggttcttcagctgactgatgccgattac
ggttttctcgtcagtgtctcaggggcaggggttattgcgggggcgcttgtcaatgtgttc
tttaataaaaaaatgccggcttctttattgatgggaatgggctctttattcacagcggca
ggatatatgatttatgcgttttctgacgttttttggacggctgctttcggatttttcctt
ctcgctttttttctggcgtttgccaatacgggatttcagacattttatcaaaaaaatgtt
ccggtggacattatggggagagtggggagcttttattcattagtcgaagccgtcttcatt
atagtggtaacggcggttttcggagcggcggctgtcagttcttccgtccgcggcatcgtc
atcgcaggggctgctgttatgctggcgttggcagccattttatgctcgttcttatttgcg
gcctcaaaaaggaggactcccgatgtatttcaagcggatcaatttaaacaaacataa

DBGET integrated database retrieval system