KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2472Help
Entry
BAMF_2472         CDS       T01321                                 

Gene name
spoIIIC
Definition
(GenBank) RNA polymerase sporulation-specific sigma-K factor precursor (Sigma-27) (C-terminal fragment)
  KO
K03091  RNA polymerase sporulation-specific sigma factor
Organism
bao  Bacillus amyloliquefaciens DSM 7
Brite
KEGG Orthology (KO) [BR:bao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bao03021]
    BAMF_2472 (spoIIIC)
Transcription machinery [BR:bao03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BAMF_2472 (spoIIIC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4 HTH_23 HTH_3 HTH_28 MarR_2 HTH_19 KORA HTH_29 HTH_38 HTH_24 HTH_31 Trp_repressor GerE HTH_10 HTH_25 HTH_5 TrmB KorB HTH_Crp_2 Sigma70_r4_2 HTH_37 MarR
Motif
Other DBs
NCBI-ProteinID: CBI43598
Position
2515157..2515879
Genome map
AA seq 240 aa AA seqDB search
MTGVFAALGFIVKELVFLVSYVKNNAFPQPLSNSEEKKYLDLMAEGDEHARNMLIEHNLR
LVAHIVKKFENTGEDAEDLISIGTIGLIKGIESYSAGKGTKLATYAARCIENEILMHLRA
LKKTKKDVSLHDPIGQDKEGNEISLIDVLKSESEDVIDTIQLNMELEKVKKYIDILDDRE
KEVIVGRFGLDLKKEKTQREIAKELGISRSYVSRIEKRALMKMFHEFYRAEKEKRKKKGK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggtgtttttgcagcgctcgggtttattgtgaaagaactcgtgtttttagtatca
tacgtgaaaaataatgcctttccacaaccgctctcaaatagtgaggagaaaaaatactta
gaccttatggccgaaggagatgaacacgcccgcaatatgctgatcgaacataatctccgt
ttagtcgcccatattgtaaaaaaattcgaaaacacgggagaagacgcagaagatctgatc
tccatcggtacaatcgggctgatcaaaggaattgaaagctactcagccggaaaaggcacg
aagcttgccacatatgccgcacgatgtattgagaatgagattttaatgcatctgcgcgca
ttgaaaaaaacgaaaaaagacgtctcccttcatgacccgatcggccaggataaagaaggg
aatgaaataagcctgattgatgttctcaagtcggaaagcgaagatgtgatcgacaccatt
cagctcaacatggaacttgaaaaggtcaaaaaatatattgatattttagacgaccgcgaa
aaagaagtcatcgtcggccgcttcgggcttgatttaaaaaaagaaaaaacgcagcgcgag
atcgcaaaggagctcggcatttcaaggagttatgtgtcgcggattgaaaaacgcgcattg
atgaagatgtttcatgagttttaccgggcggaaaaggagaagcggaagaagaagggaaag
tga

DBGET integrated database retrieval system