KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2474Help
Entry
BAMF_2474         CDS       T01321                                 

Gene name
old
Definition
(GenBank) Overcoming lysogenization defect protein
Organism
bao  Bacillus amyloliquefaciens DSM 7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_15 AAA_21 DUF2813 AAA_23 SMC_N AAA_29 ABC_tran AAA_27 CsgA MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: CBI43600
Position
complement(2516500..2518314)
Genome map
AA seq 604 aa AA seqDB search
MANINLSYLRVSNFRSIEKIEVDLFDFTSLIGPNNCGKSSIIRAIEIFLNQSKPSIDEWR
KGFENEEIIIEGVFDHILDWERDTPGVAGLVNDGKIKLRLRASLKDGKVESFYEAYIKQY
EINGFQEKWSENSHTIKQIATSLGIDGTKWRTKANRERVKEEIKQTNPELVTLSEEDWTS
ENISIAPALKQALPNAVIIPAVKDASDELKPTNTTIFGTLLKQIILPAIQNMNEYRNLME
NVELLSKKLSGELEEETPIISQLTNDISNRMSSIIESKIKFAMSTPDTNKFVGNYTTLLM
DDGVETTIERQGHGSQRALIFALIEVLANHSSKNTSEEMTRSTILLFEEPELYLHPHLMI
RLKNALKYISKQTQWQVLISTHSPFLIDVVENPMSLAILNRKNSSEAPYINQLKQDPFEK
GINIESEKNALRASLDFHPTVNQAFFAKRVVLVEGDTEKSLFNHRLRVHEHYEISEEVFN
TTTIVSCGGKWTIVPFAKLLKAFKIPFRIVHDCDRKDRTDEELESIRGIDPYKANEQIRI
AADGEQIFLVEDTLENLLWEKGTKIPSKDKPFRTWKRINDLMENREELEKFPRLKDLFDF
VYKW
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaatataaatctttcatatctaagggtcagtaattttagaagtatagaaaaaata
gaagttgatttatttgactttacaagtttaatagggcctaataactgtggaaaatcttca
ataatacgagcaatcgaaatttttctaaaccaatctaaacctagtattgatgagtggaga
aaaggttttgaaaatgaagaaataataatagaaggtgtatttgatcatatcttagactgg
gaaagggatactcctggtgttgcggggttggtgaatgatggtaaaataaaacttcggcta
agagctagtttaaaagatggcaaggtggaaagtttctatgaagcatacataaaacaatac
gaaattaatggatttcaggagaagtggagcgagaattcgcatacaatcaaacaaatagct
acttcattaggaattgacggaacaaaatggaggacgaaagcgaatagagaaagagttaaa
gaggagataaaacaaacaaatccagagttagtgactctctctgaagaggattggacttct
gaaaatattagtattgccccagctttaaagcaggctttgcctaatgcagtaataattcca
gctgttaaagatgcttcagatgaactaaaaccaaccaatactacgatttttggtacactt
ttaaaacaaataatcttacctgctattcaaaatatgaacgaatatagaaacctaatggaa
aatgttgaactcctttctaaaaaattatccggtgaattagaagaagagacaccgattatc
agtcaattaaccaacgatatttcaaatagaatgtcttcaatcattgaatctaagataaag
tttgcaatgtccactcccgatacaaataaattcgttggaaattatacaaccctattaatg
gacgatggcgtggagacaacgattgaaagacagggacatggctctcagagggccttaata
tttgccttaattgaagttcttgctaaccattcttcaaagaatacttcagaagaaatgact
aggtctacaattttactctttgaagaacctgaattgtaccttcatcctcatttaatgatt
agattgaaaaatgcattgaaatatatatcaaagcaaacccagtggcaagtattaatcagc
actcattctccttttttgattgatgttgtagaaaatccaatgtcactagctattttaaat
agaaaaaattcaagtgaagccccatatatcaatcagttaaaacaagatccttttgaaaag
ggtatcaatatagaaagtgaaaaaaatgctctaagagcttctttagattttcaccctaca
gttaatcaagctttctttgcaaaaagagttgttttagttgagggcgatactgaaaaaagt
ttatttaatcatagattaagggttcatgaacattatgaaatatctgaggaagtatttaat
actacaacaattgtttcttgtggaggaaaatggactattgtgccttttgcaaaattgcta
aaagcatttaaaattccatttaggatcgtacatgattgcgacagaaaggataggacagat
gaagaattggagtctattaggggcatagacccttataaggctaatgaacagattagaatt
gcagctgatggagaacaaattttcttagttgaagataccctagaaaatctcctttgggag
aaggggactaagattccttcaaaagataaaccctttcgaacttggaaaaggataaatgat
cttatggaaaaccgagaagaattagagaaatttcctaggttgaaggatttatttgatttt
gtatataaatggtga

DBGET integrated database retrieval system