KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2475Help
Entry
BAMF_2475         CDS       T01321                                 

Gene name
fabG3
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00061  Fatty acid biosynthesis
bao00780  Biotin metabolism
bao01040  Biosynthesis of unsaturated fatty acids
bao01100  Metabolic pathways
bao01130  Biosynthesis of antibiotics
bao01212  Fatty acid metabolism
Module
bao_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BAMF_2475 (fabG3)
   01040 Biosynthesis of unsaturated fatty acids
    BAMF_2475 (fabG3)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAMF_2475 (fabG3)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    BAMF_2475 (fabG3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bao01004]
    BAMF_2475 (fabG3)
Enzymes [BR:bao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     BAMF_2475 (fabG3)
Lipid biosynthesis proteins [BR:bao01004]
 Fatty acid synthase
  Component type
   BAMF_2475 (fabG3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase GST_C_2 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: CBI43601
Position
complement(2519394..2520125)
Genome map
AA seq 243 aa AA seqDB search
MKGRVAIVTGAAHGIGRAVAAQLVTSGCQVALLDKNIDSLGSQDGSMRCEVDVTNSDQVH
QAFQSVNKELGRIDILVNAVGGSQHSKLIETIEDSDWNTTFELNLRSVFNCTRAAIPDMK
KRDWGRVVNITAVAGRTYTFFGGADFTAAKAAVIGFTRQCAFELAPYGITVNAVAPGLTL
TERVESMWAEYNEEKRASILERIPIGRPSTVQEQAETICFLCSEHASYICGAILDVNGAM
FVG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggcgcgtagcaattgttactggtgcagcacatgggatcggacgtgccgttgcg
gcacagttagtgacaagtggatgtcaagttgcgttactagacaagaatatcgacagcctt
ggctcgcaagatggttcgatgcgttgcgaggttgatgtcactaacagtgaccaagttcat
caggcattccagtctgtaaacaaagaacttgggcggatagatattctggtgaacgcagtg
ggtggaagtcaacattcgaaattaatcgagacgatagaggatagcgactggaacacaacg
tttgaattgaatttacgaagcgtgtttaattgtacgcgtgccgcaattcctgatatgaaa
aagcgtgattgggggcgagtggtcaacatcacggctgttgctggaagaacctacaccttc
ttcggtggagcagacttcaccgctgccaaagcagctgttattggttttacgcgacaatgc
gcgtttgagttggccccctatgggatcaccgtgaacgccgtagcccctggactgacgctc
actgaacgagtggagtcaatgtgggcggaatacaatgaggagaagcgagcatcgatccta
gagcggatcccgattggacgcccgtctactgtgcaagagcaggctgaaacgatctgtttt
ttgtgtagcgagcatgcctcttacatttgtggcgcaatacttgatgtcaacggggcgatg
ttcgttggctag

DBGET integrated database retrieval system