KEGG   Bacillus amyloliquefaciens DSM 7: BAMF_2834Help
Entry
BAMF_2834         CDS       T01321                                 

Gene name
ytpA
Definition
(GenBank) phospholipase component of bacilysocin synthesis or export
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
bao  Bacillus amyloliquefaciens DSM 7
Pathway
bao00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bao00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAMF_2834 (ytpA)
Enzymes [BR:bao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BAMF_2834 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 PGAP1 Peptidase_S9 Chlorophyllase2 Abhydrolase_5 Abhydrolase_2 Thioesterase LCAT Ser_hydrolase Abhydrolase_3 DUF1350
Motif
Other DBs
NCBI-ProteinID: CBI43960
Position
complement(2886212..2886991)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVGTIVIIHGASEYHGRYKWLVEMWRSSGYNVVMGDLPGQGTSTRARGHIRS
FQEYIDEVDIWIDQARTLESPVFLLGHSMGGLIAIEWFKQQRNPRITALILSSPCLGLQI
KVNKVLDFASKGLNVLAPSLRVDSGLSPDMATRNADMIEADQNDSLYVTKVSVRWYRELL
KTIDAAMVPTDAFLKVPLLLMQGGDDKIVDKMKVRKWFSGVASHNKSYREWEGLYHEIFN
EPEREAVFKAAKAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacttggaaagcagacaggcccgtcggtaccattgtcataatccacggggcaagc
gaataccacgggcgttataaatggctcgttgaaatgtggagatcttccggatataacgtg
gtgatgggtgatttgcccggtcagggaacatccacccgcgccagagggcatattcgctct
ttccaagaatacattgatgaagtagatatatggattgatcaagcgagaacgcttgaatcg
cccgttttccttttgggccacagcatgggcggactgattgcgatagaatggtttaagcag
cagagaaatccccgcattacggcactcattttatcatcaccttgtcttgggctgcaaata
aaagtcaataaagtgcttgattttgcgtctaaaggactgaatgttctcgccccgtccctc
agagtggactccggtttatcgcctgatatggcgacaaggaatgcggatatgattgaagcg
gatcaaaacgattctttatatgtcacgaaagtatctgtaagatggtacagagagctttta
aaaaccattgatgccgctatggtgccgactgatgcgtttttaaaagtgccgcttttgctt
atgcagggcggtgatgacaaaatcgttgataaaatgaaggtccgtaaatggttttccggt
gtggcttcccataataaatcataccgggaatgggaagggctttatcatgaaatttttaat
gaaccggaaagagaagctgtgtttaaggcggcgaaagcctttacagatcagtatatttga

DBGET integrated database retrieval system